GLT28D1 (ALG13) (NM_001257235) Human Tagged ORF Clone

CAT#: RG235424

ALG13 (tGFP-tagged) - Human ALG13, UDP-N-acetylglucosaminyltransferase subunit (ALG13), transcript variant 9

Product Images

Circular map for RG235424

Specifications

Product Data

• Tag: TurboGFP
• Symbol: GLT28D1
• Synonyms: CDG1S; CXorf45; DEE36; EIEE36; GLT28D1; MDS031; TDRD13; YGL047W
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG235424 representing NM_001257235.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGAACAATCATCAGCTGGAACTGGCAAAGCAGCTACACAAAGAGGGTCATCTCTTCTATTGTACCTGC
  AGCACGCTTCCTGGGCTGTTACAGTCAATGGACTTATCAACACTGAAATGTTATCCTCCTGGCCAGCCA
  GAAAAATTTTCTGCATTTTTGGATAAAGTTGTTGGATTACAAAAA
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
  
  Protein Sequence

  >Peptide sequence encoded by RG235424
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
  TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
  MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
  SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
  FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001257235
• ORF Size: 183 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).

Reference Data

• RefSeq: NM_001257235.3
• RefSeq Size: 2962 bp
• RefSeq ORF: 186 bp
• Locus ID: 79868
• Cytogenetics: Xq23
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis
• MW: 7.3 kDa
• Gene Summary: The protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linked glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009]