XPNPEP3 (NM_001204827) Human Tagged ORF Clone

CAT#: RG235420

XPNPEP3 (tGFP-tagged) - Human X-prolyl aminopeptidase (aminopeptidase P) 3, putative (XPNPEP3), transcript variant 2

Product Images

Circular map for RG235420

Specifications

Product Data

• Tag: TurboGFP
• Symbol: XPNPEP3
• Synonyms: APP3; ICP55; NPHPL1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG235420 representing NM_001204827.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGCCTTGGCTGCTCTCAGCCCCCAAGCTGGTTCCCGCTGTAGCAAACGTCCGCGGCCTCTCAGGGTCT
  TACTTTGTCACCCAAGCTGGAGTGCAGTGGCGTGATCCCATTACACTGCAACCTATGTCTTCCAGGCTC
  AAGCAGTCTTTCTACCAGCTTCCCGAG
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
  
  Protein Sequence

  >Peptide sequence encoded by RG235420
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MPWLLSAPKLVPAVANVRGLSGSYFVTQAGVQWRDPITLQPMSSRLKQSFYQLPE
  TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
  MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
  SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
  FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001204827
• ORF Size: 165 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).

Reference Data

• RefSeq: NM_001204827.1, NP_001191756.1
• RefSeq Size: 1462 bp
• RefSeq ORF: 168 bp
• Locus ID: 63929
• Cytogenetics: 22q13.2
• Protein Families: Druggable Genome, Protease
• MW: 6.6 kDa
• Gene Summary: The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.[provided by RefSeq, Mar 2011]