PSG5 (NM_001130014) Human Tagged ORF Clone

CAT#: RG225493

Reviews ()
Write a review
  • TrueORF®

PSG5 (GFP-tagged) - Human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 2



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 657.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PSG5
Synonyms FL-NCA-3; PSG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG225493 representing NM_001130014
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCCTCTCAGCCCCTCCCTGCACACAGCACATCACCTGGAAGGGGCTCCTGCTCACAGCATCAC
TTTTAAACTTCTGGAACCTGCCTATCACTGCTCAAGTCACGATTGAAGCCCTGCCACCCAAAGTTTCCGA
GGGGAAGGATGTTCTTCTACTTGTCCACAATTTGCCTCAGAATCTTGCTGGCTACATCTGGTACAAAGGA
CAACTGATGGACCTCTACCATTACATTACATCATATGTAGTAGACGGTCAAATAAATATATATGGGCCTG
CATACACTGGACGAGAAACAGTATATTCCAATGCATCCCTGCTGATCCAGAATGTCACCCGGGAAGACGC
AGGATCCTACACCTTACACATCATAAAGCGAGGTGATAGGACTAGAGGAGTAACTGGATATTTCACCTTC
AACTTATACCTGAAGCTGCCCAAGCCCTACATCACCATCAACAACTCAAAACCCAGGGAGAATAAGGATG
TCTTAGCCTTCACCTGTGAACCTAAGAGTGAGAACTACACCTACATTTGGTGGCTAAATGGTCAGAGCCT
CCCGGTCAGTCCCAGGGTAAAGCGACCCATTGAAAACAGGATCCTCATTCTACCCAGTGTCACGAGAAAT
GAAACAGGACCCTATGAATGTGAAATACGGGACCGAGATGGTGGCATGCGCAGTGACCCAGTCACCCTGA
ATGTCCTCTATGGTCCAGACCTCCCCAGCATTTACCCTTCATTCACCTATTACCGTTCAGGAGAAAACCT
CTACTTGTCCTGCTTCGCGGAATCTAACCCACCGGCAGAGTATTTTTGGACAATTAATGGGAAGTTTCAG
CAATCAGGACAAAAGCTCTCTATCCCCCAAATTACTACAAAGCATAGAGGGCTCTATACTTGCTCTGTTC
GTAACTCAGCTACTGGCAAGGAAAGCTCCAAATCCATGACAGTCGAAGTCTCTGCTCCTTCAGGAATAGG
ACGTCTTCCTCTCCTTAATCCAATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG225493 representing NM_001130014
Red=Cloning site Green=Tags(s)

MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG
QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF
NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRN
ETGPYECEIRDRDGGMRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ
QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001130014
ORF Size 1005 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001130014.2
RefSeq Size 1601 bp
RefSeq ORF 1008 bp
Locus ID 5673
UniProt ID Q15238
Cytogenetics 19q13.31
Protein Families Secreted Protein
Gene Summary The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009]
Other products for "PSG5"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.