CHD4 (NM_001273) Human Tagged ORF Clone

CAT#: RG224232

CHD4 (GFP-tagged) - Human chromodomain helicase DNA binding protein 4 (CHD4)

Change vector?

  • TrueORF®

USD 2,194


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CHD4 (NM_001273) Human Tagged ORF Clone
Symbol CHD4
Synonyms CHD-4; Mi-2b; Mi2-BETA
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG224232 representing NM_001273
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCGGGCCTGGGCTCCCCGTCCCCCTGCTCGGCGGGCAGTGAGGAGGAGGATATGGATGCACTTT
TGAACAACAGCCTGCCCCCACCCCACCCAGAAAATGAAGAGGACCCAGAAGAGGATTTGTCAGAAACAGA
GACTCCAAAGCTCAAGAAGAAGAAAAAGCCTAAGAAACCTCGGGACCCTAAAATCCCTAAGAGCAAGCGC
CAAAAAAAGGAGCGTATGCTCTTATGCCGGCAGCTGGGGGACAGCTCTGGGGAGGGGCCAGAGTTTGTGG
AGGAGGAGGAAGAGGTGGCTCTGCGCTCAGACAGTGAGGGCAGCGACTATACTCCTGGCAAGAAGAAGAA
GAAGAAGCTTGGACCTAAGAAAGAGAAGAAGAGCAAATCCAAGCGGAAGGAGGAGGAGGAGGAGGAGGAT
GATGATGATGATTCAAAGGAGCCTAAATCATCTGCTCAGCTCCTGGAAGACTGGGGCATGGAAGACATTG
ACCACGTGTTCTCAGAGGAGGATTATCGAACCCTCACCAACTACAAGGCCTTCAGCCAGTTTGTCAGACC
CCTCATTGCTGCCAAAAATCCCAAGATTGCTGTCTCCAAGATGATGATGGTTTTGGGTGCAAAATGGCGG
GAGTTCAGTACCAATAACCCCTTCAAAGGCAGTTCTGGGGCATCAGTGGCAGCTGCGGCAGCAGCAGCGG
TAGCTGTGGTGGAGAGCATGGTGACAGCCACTGAGGTTGCACCACCACCTCCCCCTGTGGAGGTGCCTAT
CCGCAAGGCCAAGACCAAGGAGGGCAAAGGTCCCAATGCTCGGAGGAAGCCCAAGGGCAGCCCTCGTGTA
CCTGATGCCAAGAAGCCTAAACCCAAGAAAGTAGCTCCCCTGAAAATCAAGCTGGGAGGTTTTGGTTCCA
AGCGTAAGAGATCCTCGAGTGAGGATGATGACTTAGATGTGGAATCTGACTTCGATGATGCCAGTATCAA
TAGCTATTCTGTTTCTGATGGTTCCACCAGCCGTAGTAGCCGCAGCCGCAAGAAACTCCGAACCACTAAA
AAGAAAAAGAAAGGCGAGGAGGAGGTGACTGCTGTGGATGGTTATGAGACAGACCACCAGGACTATTGCG
AGGTGTGCCAGCAAGGCGGTGAGATCATCCTGTGTGATACCTGTCCCCGTGCTTACCACATGGTCTGCCT
GGATCCCGACATGGAGAAGGCTCCCGAGGGCAAGTGGAGCTGCCCACACTGCGAGAAGGAAGGCATCCAG
TGGGAAGCTAAAGAGGACAATTCGGAGGGTGAGGAGATCCTGGAAGAGGTTGGGGGAGACCTCGAAGAGG
AGGATGACCACCATATGGAATTCTGTCGGGTCTGCAAGGATGGTGGGGAACTGCTCTGCTGTGATACCTG
TCCTTCTTCCTACCACATCCACTGCCTGAATCCCCCACTTCCAGAGATCCCCAACGGTGAATGGCTCTGT
CCCCGTTGTACGTGTCCAGCTCTGAAGGGCAAAGTGCAGAAGATCCTAATCTGGAAGTGGGGTCAGCCAC
CATCTCCCACACCAGTGCCTCGGCCTCCAGATGCTGATCCCAACACGCCCTCCCCAAAGCCCTTGGAGGG
GCGGCCAGAGCGGCAGTTCTTTGTGAAATGGCAAGGCATGTCTTACTGGCACTGCTCCTGGGTTTCTGAA
CTGCAGCTGGAGCTGCACTGTCAGGTGATGTTCCGAAACTATCAGCGGAAGAATGATATGGATGAGCCAC
CTTCTGGGGACTTTGGTGGTGATGAAGAGAAAAGCCGAAAGCGAAAGAACAAGGACCCTAAATTTGCAGA
GATGGAGGAACGCTTCTATCGCTATGGGATAAAACCCGAGTGGATGATGATCCACCGAATCCTCAACCAC
AGTGTGGACAAGAAGGGCCACGTCCACTACTTGATCAAGTGGCGGGACTTACCTTACGATCAGGCTTCTT
GGGAGAGTGAGGATGTGGAGATCCAGGATTACGACCTGTTCAAGCAGAGCTATTGGAATCACAGGGAGTT
AATGAGGGGTGAGGAAGGCCGACCAGGCAAGAAGCTCAAGAAGGTGAAGCTTCGGAAGTTGGAGAGGCCT
CCAGAAACGCCAACAGTTGATCCAACAGTGAAGTATGAGCGACAGCCAGAGTACCTGGATGCTACAGGTG
GAACCCTGCACCCCTATCAAATGGAGGGCCTGAATTGGTTGCGCTTCTCCTGGGCTCAGGGCACTGACAC
CATCTTGGCTGATGAGATGGGCCTTGGGAAAACTGTACAGACAGCAGTCTTCCTGTATTCCCTTTACAAG
GAGGGTCATTCCAAAGGCCCCTTCCTAGTGAGCGCCCCTCTTTCTACCATCATCAACTGGGAGCGGGAGT
TTGAAATGTGGGCTCCAGACATGTATGTCGTAACCTATGTGGGTGACAAGGACAGCCGTGCCATCATCCG
AGAGAATGAGTTCTCCTTTGAAGACAATGCCATTCGTGGTGGCAAGAAGGCCTCCCGCATGAAGAAAGAG
GCATCTGTGAAATTCCATGTGCTGCTGACATCCTATGAATTGATCACCATTGACATGGCTATTTTGGGCT
CTATTGATTGGGCCTGCCTCATCGTGGATGAAGCCCATCGGCTGAAGAACAATCAGTCTAAGTTCTTCCG
GGTATTGAATGGTTACTCACTCCAGCACAAGCTGTTGCTGACTGGGACACCATTACAAAACAATCTGGAA
GAGTTGTTTCATCTGCTCAACTTTCTCACCCCCGAGAGGTTCCACAATTTGGAAGGTTTTTTGGAGGAGT
TTGCTGACATTGCCAAGGAGGACCAGATAAAAAAACTGCATGACATGCTGGGGCCGCACATGTTGCGGCG
GCTCAAAGCCGATGTGTTCAAGAACATGCCCTCCAAGACAGAACTAATTGTGCGTGTGGAGCTGAGCCCT
ATGCAGAAGAAATACTACAAGTACATCCTCACTCGAAATTTTGAAGCACTCAATGCCCGAGGTGGTGGCA
ACCAGGTGTCTCTGCTGAATGTGGTGATGGATCTTAAGAAGTGCTGCAACCATCCATACCTCTTCCCTGT
GGCTGCAATGGAAGCTCCTAAGATGCCTAATGGCATGTATGATGGCAGTGCCCTAATCAGAGCATCTGGG
AAATTATTGCTGCTGCAGAAAATGCTCAAGAACCTTAAGGAGGGTGGGCATCGTGTACTCATCTTTTCCC
AGATGACCAAGATGCTAGACCTGCTAGAGGATTTCTTGGAACATGAAGGTTATAAATACGAACGCATCGA
TGGTGGAATCACTGGGAACATGCGGCAAGAGGCCATTGACCGCTTCAATGCACCGGGTGCTCAGCAGTTC
TGCTTCTTGCTTTCCACTCGAGCTGGGGGCCTTGGAATCAATCTGGCCACTGCTGACACAGTTATTATCT
ATGACTCTGACTGGAACCCCCATAATGACATTCAGGCCTTTAGCAGAGCTCACCGGATTGGGCAAAATAA
AAAGGTAATGATCTACCGGTTTGTGACCCGTGCGTCAGTGGAGGAGCGCATCACGCAGGTGGCAAAGAAG
AAAATGATGCTGACGCATCTAGTGGTGCGGCCTGGGCTGGGCTCCAAGACTGGATCTATGTCCAAACAGG
AGCTTGATGATATCCTCAAATTTGGCACTGAGGAACTATTCAAGGATGAAGCCACTGATGGAGGAGGAGA
CAACAAAGAGGGAGAAGATAGCAGTGTTATCCACTACGATGATAAGGCCATTGAACGGCTGCTAGACCGT
AACCAGGATGAGACTGAAGACACAGAATTGCAGGGCATGAATGAATATTTGAGCTCATTCAAAGTGGCCC
AGTATGTGGTACGGGAAGAAGAAATGGGGGAGGAAGAGGAGGTAGAACGGGAAATCATTAAACAGGAAGA
AAGTGTGGATCCTGACTACTGGGAGAAATTGCTGCGGCACCATTATGAGCAGCAGCAAGAAGATCTAGCC
CGAAATCTGGGCAAAGGAAAAAGAATCCGTAAACAGGTCAACTACAATGATGGCTCCCAGGAGGACCGAG
ATTGGCAGGACGACCAGTCCGACAACCAGTCCGATTACTCAGTGGCTTCAGAGGAAGGTGATGAAGACTT
TGATGAACGTTCAGAAGCTCCCCGTAGGCCCAGTCGTAAGGGCCTGCGGAATGATAAAGATAAGCCATTG
CCTCCTCTGTTGGCCCGTGTTGGTGGGAATATTGAAGTACTTGGTTTTAATGCTCGTCAGCGAAAAGCCT
TTCTTAATGCAATTATGCGATATGGTATGCCACCTCAGGATGCTTTTACTACCCAGTGGCTTGTAAGAGA
CCTGCGAGGCAAATCAGAGAAAGAGTTCAAGGCATATGTCTCTCTTTTCATGCGGCATTTATGTGAGCCG
GGGGCAGATGGGGCTGAGACCTTTGCTGATGGTGTCCCCCGAGAAGGCCTGTCTCGCCAGCATGTCCTTA
CTAGAATTGGTGTTATGTCTTTGATTCGCAAGAAGGTTCAGGAGTTTGAACATGTTAATGGGCGCTGGAG
CATGCCTGAACTGGCTGAGGTGGAGGAAAACAAGAAGATGTCCCAGCCAGGGTCACCCTCCCCAAAAACT
CCTACACCCTCCACTCCAGGGGACACGCAGCCCAACACTCCTGCACCTGTCCCACCTGCTGAAGATGGGA
TAAAAATAGAGGAAAATAGCCTCAAAGAAGAAGAGAGCATAGAAGGAGAAAAGGAGGTTAAATCTACAGC
CCCTGAGACTGCCATTGAGTGTACACAGGCCCCTGCCCCTGCCTCAGAGGATGAAAAGGTCGTTGTTGAA
CCCCCTGAGGGAGAGGAGAAAGTGGAAAAGGCAGAGGTGAAGGAGAGAACAGAGGAACCTATGGAGACAG
AGCCCAAAGGTGCTGCTGATGTAGAGAAGGTGGAGGAAAAGTCAGCAATAGATCTGACCCCTATTGTGGT
AGAAGACAAAGAAGAGAAGAAAGAAGAAGAAGAGAAAAAAGAGGTGATGCTTCAGAATGGAGAGACCCCC
AAGGACCTGAATGATGAGAAACAGAAGAAAAATATTAAACAACGTTTCATGTTTAACATTGCAGATGGTG
GTTTTACTGAGTTGCACTCCCTTTGGCAGAATGAAGAGCGGGCAGCCACAGTTACCAAGAAGACTTATGA
GATCTGGCATCGACGGCATGACTACTGGCTGCTAGCCGGCATTATAAACCATGGCTATGCCCGGTGGCAA
GACATCCAGAATGACCCACGCTATGCCATCCTCAATGAGCCTTTCAAGGGTGAAATGAACCGTGGCAATT
TCTTAGAGATCAAGAATAAATTTCTAGCTCGAAGGTTTAAGCTCTTAGAACAAGCTCTGGTGATTGAGGA
ACAGCTGCGCCGGGCTGCTTACTTGAACATGTCAGAAGACCCTTCTCACCCTTCCATGGCCCTCAACACC
CGCTTTGCTGAGGTGGAGTGTTTGGCGGAAAGTCATCAGCACCTGTCCAAGGAGTCAATGGCAGGAAACA
AGCCAGCCAATGCAGTCCTGCACAAAGTTCTGAAACAGCTGGAAGAACTGCTGAGTGACATGAAAGCTGA
TGTGACTCGACTCCCAGCTACCATTGCCCGAATTCCCCCAGTTGCTGTGAGGTTACAGATGTCAGAGCGT
AACATTCTCAGCCGCCTGGCAAACCGGGCACCCGAACCTACCCCACAGCAGGTAGCCCAGCAGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG224232 representing NM_001273
Red=Cloning site Green=Tags(s)

MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKR
QKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEED
DDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWR
EFSTNNPFKGSSGASVAAAAAAAVAVVESMVTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRV
PDAKKPKPKKVAPLKIKLGGFGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTK
KKKKGEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLC
PRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSE
LQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNH
SVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERP
PETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYK
EGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLE
ELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSP
MQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASG
KLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQF
CFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKK
KMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLA
RNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPL
PPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEP
GADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKT
PTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVE
PPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQ
DIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNT
RFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSER
NILSRLANRAPEPTPQQVAQQQ

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001273
ORF Size 5736 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001273.2, NP_001264
RefSeq Size 6511
RefSeq ORF 5739
Locus ID 1108
Cytogenetics 12p13.31
Domains SNF2_N, chromo, DEXDc, helicase_C, PHD
Protein Families Transcription Factors, Druggable Genome
Gene Summary The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations