GAS2L1 (NM_152236) Human Tagged ORF Clone

CAT#: RG211855

Reviews ()
Write a review
  • TrueORF®

GAS2L1 (GFP-tagged) - Human growth arrest-specific 2 like 1 (GAS2L1), transcript variant 2

  View "NM_152236" in other vectors (10)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 650.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GAS2L1 (NM_152236) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol GAS2L1
Synonyms GAR22
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG211855 representing NM_152236
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGACCCAGTGGCGGGCATCGCGGGTTCGGCGGCCAAGAGCGTGCGGCCATTTCGCTCCAGTGAGG
CCTACGTGGAGGCCATGAAGGAGGACCTGGCCGAGTGGCTCAATGCCTTGTACGGCCTGGGTCTCCCGGG
TGGTGGCGATGGCTTCCTGACAGGGCTGGCCACGGGCACGACCCTGTGCCAACATGCCAACGCCGTGACC
GAGGCTGCCCGTGCATTGGCAGCCGCCCGCCCGGCCCGAGGTGTGGCCTTCCAGGCGCACAGTGTAGTGC
CTGGCTCCTTCATGGCGCGCGACAACGTGGCCACCTTCATCGGCTGGTGCCGCGTGGAGCTGGGTGTGCC
GGAGGTGCTCATGTTTGAGACTGAGGACCTGGTGCTGCGCAAGAACGAGAAGAGCGTGGTGCTGTGCCTG
CTGGAGGTGGCGCGGCGTGGGGCACGCCTGGGCCTGCTGGCCCCACGCCTCGTGCAGTTTGAGCAGGAGA
TTGAGCGGGAGCTGCGTGCTGCACCCCCAGCCCCCAACGCCCCTGCCGCTGGGGAGGACACCACTGAAAC
CGCCCCCGCACCAGGGACTCCTGCCCGCGGCCCCCGCATGACACCCAGCGACCTGCGCAACCTCGACGAG
CTGGTGAGGGAGATTCTGGGCCGCTGCACCTGCCCTGACCAGTTTCCCATGATCAAGGTCTCAGAGGGGA
AGTACCGTGTGGGGGACTCGAGCCTGCTCATCTTTGTGCGGGTGCTGAGGAGCCACGTGATGGTGCGAGT
GGGTGGTGGCTGGGACACGCTGGAGCATTACCTGGACAAGCACGACCCGTGCCGCTGCTCCTCCACTGCT
CATCGCCCACCCCAGCCGAGGGTCTGCACCTTTTCTCCACAGAGGGTGTCGCCCACCACCAGTCCCCGCC
CTGCTAGCCCAGTCCCTGGGAGTGAGCGCCGGGGCTCCCGGCCTGAGATGACTCCCGTTAGCTTACGAAG
CACAAAGGAGGGGCCCGAGACCCCACCCAGGCCCCGGGATCAGCTGCCCCCCCATCCCCGCTCCCGCCGC
TACTCCGGGGACAGTGACTCCTCAGCCTCCTCCGCCCAGAGCGGCCCCCTTGGTACCCGCAGTGATGACA
CAGGCACTGGCCCCCGGAGGGAGCGACCCAGCCGGCGGCTGACCACAGGCACCCCGGCCTCTCCGAGACG
GCCTCCTGCCCTGCGCAGCCAGTCCCGAGACCGGCTGGATCGCGGCCGGCCCCGGGGGGCCCCAGGAGGC
AGGGGAGCCCAGCTGTCGGTCCCCAGCCCTGCCCGGCGGGCCCGGAGCCAGAGCCGCGAGGAGCAGGCTG
TGCTGCTTGTGCGCAGGGATCGAGACGGGCAGCACTCATGGGTGCCAAGGGGCAGGGGCAGTGGGGGCTC
GGGCAGGAGCACCCCCCAGACTCCCCGTGCCCGCAGCCCTGCAGCACCCCGGCTTTCCCGGGTCTCCAGC
CCCAGTCCAGAGTTGGGCACCACACCGGCCAGCATCTTCCGCACACCCCTGCAGCTCGACCCGCAGCAGG
AGCAGCAGCTGTTCCGGCGCCTGGAAGAGGAGTTCCTGGCCAATGCCCGGGCCCTTGAGGCTGTTGCTAG
CGTGACCCCCACTGGACCAGCCCCTGACCCAGCTCGGGCCCCCGACCCTCCAGCTCCTGACTCTGCCTAT
TGTTCCTCCAGTTCCTCCTCTTCGTCCCTCAGCGTCCTGGGTGGCAAATGTGGCCAACCTGGGGACTCTG
GCCGGACGGCCAATGGGCTGCCTGGGCCCCGAAGCCAAGCCCTTTCCAGCTCCTCCGATGAAGGCAGCCC
CTGCCCTGGCATGGGGGGGCCACTAGATGCACCTGGGAGCCCCCTGGCTTGCACTGAACCCTCGAGGACC
TGGGCACGGGGTCGGATGGACACACAGCCAGACCGTAAACCCTCACGTATCCCCACGCCTCGGGGCCCCC
GCCGCCCCTCCGGACCCGCAGAGCTGGGGACATGGCATGCCCTGCACTCAGTCACCCCGAGGGCTGAGCC
AGATTCCTGGATG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG211855 representing NM_152236
Red=Cloning site Green=Tags(s)

MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGTTLCQHANAVT
EAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCL
LEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAAGEDTTETAPAPGTPARGPRMTPSDLRNLDE
LVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTA
HRPPQPRVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRR
YSGDSDSSASSAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGG
RGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSPAAPRLSRVSS
PSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTPTGPAPDPARAPDPPAPDSAY
CSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSSSSDEGSPCPGMGGPLDAPGSPLACTEPSRT
WARGRMDTQPDRKPSRIPTPRGPRRPSGPAELGTWHALHSVTPRAEPDSWM

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_152236
ORF Size 2043 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_152236.1, NP_689422.1
RefSeq Size 2533
RefSeq ORF 2046
Locus ID 10634
Cytogenetics 22q12.2
Domains CH, GAS2
Gene Summary This gene encodes a member of the growth arrest-specific 2 protein family. This protein binds components of the cytoskeleton and may be involved in mediating interactions between microtubules and microfilaments. This protein localizes to the proximal end of mature centrioles and links centrosomes to both microtubules and actin. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 9. [provided by RefSeq, May 2018]

Other Versions

Other products for "GAS2L1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00


Rabbit Polyclonal antibody to GAS2L1 (growth arrest-specific 2 like 1)
    • 100 ul

USD 415.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones