alpha 1 Glycine Receptor(GLRA1) (NM_000171) Human Tagged ORF Clone

CAT#: RG210390

GLRA1 (GFP-tagged) - Human glycine receptor, alpha 1 (GLRA1), transcript variant 2

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name alpha 1 Glycine Receptor(GLRA1) (NM_000171) Human Tagged ORF Clone
Symbol GLRA1
Synonyms HKPX1; STHE
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG210390 representing NM_000171
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACAGCTTCAATACTCTTCGACTCTACCTTTGGGAGACCATTGTATTCTTCAGCCTTGCTGCTTCTA
AGGAGGCTGAAGCTGCTCGCTCCGCACCCAAGCCTATGTCACCCTCGGATTTCCTGGATAAGCTAATGGG
GAGAACCTCCGGATATGATGCCAGGATCAGGCCCAATTTTAAAGGTCCCCCAGTGAACGTGAGCTGCAAC
ATTTTCATCAACAGCTTTGGTTCCATTGCTGAGACAACCATGGACTATAGGGTCAACATCTTCCTGCGGC
AGCAATGGAACGACCCCCGCCTGGCCTATAATGAATACCCTGACGACTCTCTGGACCTGGACCCATCCAT
GCTGGACTCCATCTGGAAACCTGACCTGTTCTTTGCCAACGAGAAGGGGGCCCACTTCCATGAGATCACC
ACAGACAACAAATTGCTAAGGATCTCCCGGAATGGGAATGTCCTCTACAGCATCAGAATCACCCTGACAC
TGGCCTGCCCCATGGACTTGAAGAATTTCCCCATGGATGTCCAGACATGTATCATGCAACTGGAAAGCTT
TGGATATACGATGAATGACCTCATCTTTGAGTGGCAGGAACAGGGAGCCGTGCAGGTAGCAGATGGACTA
ACTCTGCCCCAGTTTATCTTGAAGGAAGAGAAGGACTTGAGATACTGCACCAAGCACTACAACACAGGTA
AATTCACCTGCATTGAGGCCCGGTTCCACCTGGAGCGGCAGATGGGTTACTACCTGATTCAGATGTATAT
TCCCAGCCTGCTCATTGTCATCCTCTCATGGATCTCCTTCTGGATCAACATGGATGCTGCACCTGCTCGT
GTGGGCCTAGGCATCACCACTGTGCTCACCATGACCACCCAGAGCTCCGGCTCTCGAGCATCTCTGCCCA
AGGTGTCCTATGTGAAAGCCATTGACATTTGGATGGCAGTTTGCCTGCTCTTTGTGTTCTCAGCCCTATT
AGAATATGCTGCCGTTAACTTTGTGTCTCGGCAACATAAGGAGCTGCTCCGATTCAGGAGGAAGCGGAGA
CATCACAAGGAGGATGAAGCTGGAGAAGGCCGCTTTAACTTCTCTGCCTATGGGATGGGCCCAGCCTGTC
TACAGGCCAAGGATGGCATCTCAGTCAAGGGCGCCAACAACAGTAACACCACCAACCCCCCTCCTGCACC
ATCTAAGTCCCCAGAGGAGATGCGAAAACTCTTCATCCAGAGGGCCAAGAAGATCGACAAAATATCCCGC
ATTGGCTTCCCCATGGCCTTCCTCATTTTCAACATGTTCTACTGGATCATCTACAAGATTGTCCGTAGAG
AGGACGTCCACAACCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG210390 representing NM_000171
Red=Cloning site Green=Tags(s)

MYSFNTLRLYLWETIVFFSLAASKEAEAARSAPKPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVSCN
IFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPDDSLDLDPSMLDSIWKPDLFFANEKGAHFHEIT
TDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGL
TLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPAR
VGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRR
HHKEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDKISR
IGFPMAFLIFNMFYWIIYKIVRREDVHNQ

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_000171
ORF Size 1347 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000171.1, NP_000162
RefSeq Size 1715
RefSeq ORF 1350
Locus ID 2741
Cytogenetics 5q33.1
Protein Families Transmembrane, Ion Channels: Cys-loop Receptors, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations