SNRPB (NM_003091) Human Tagged ORF Clone

CAT#: RG210290

  • TrueORF®

SNRPB (tGFP-tagged) - Human small nuclear ribonucleoprotein polypeptides B and B1 (SNRPB), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_003091" in other vectors (4)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


SNRPB Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "SNRPB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SNRPB
Synonyms CCMS; COD; Sm-B/B'; SmB/B'; SmB/SmB'; snRNP-B; SNRPB1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG210290 representing NM_003091
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGTGGGCAAGAGCAGCAAGATGCTGCAGCATATTGATTACAGGATGAGGTGCATCCTGCAGGACG
GCCGGATCTTCATTGGCACCTTCAAGGCTTTTGACAAGCACATGAATTTGATCCTCTGTGACTGTGATGA
GTTCAGAAAGATCAAGCCAAAGAACTCCAAACAAGCAGAAAGGGAAGAGAAGCGAGTCCTCGGTCTGGTG
CTGCTGCGAGGGGAGAATCTGGTCTCAATGACAGTAGAGGGACCTCCTCCCAAAGATACTGGTATTGCTC
GAGTTCCACTTGCTGGAGCTGCCGGGGGCCCAGGGATCGGCAGGGCTGCTGGCAGAGGAATCCCAGCTGG
GGTTCCCATGCCCCAGGCTCCTGCAGGACTTGCTGGGCCAGTCCGTGGGGTTGGCGGGCCATCCCAACAG
GTGATGACCCCACAAGGAAGAGGTACTGTTGCAGCCGCTGCAGCTGCTGCCACAGCCAGTATTGCCGGGG
CTCCAACCCAGTACCCACCTGGCCGTGGGGGTCCTCCCCCACCTATGGGCCGAGGAGCACCCCCTCCAGG
CATGATGGGCCCACCTCCTGGTATGAGACCTCCTATGGGTCCCCCAATGGGGATCCCCCCTGGAAGAGGG
ACTCCAATGGGCATGCCCCCTCCGGGAATGCGGCCTCCTCCCCCTGGGATGCGAGGCCTTCTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210290 representing NM_003091
Red=Cloning site Green=Tags(s)

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLV
LLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQ
VMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRG
TPMGMPPPGMRPPPPGMRGLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003091
ORF Size 693 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003091.4
RefSeq Size 1153 bp
RefSeq ORF 696 bp
Locus ID 6628
UniProt ID P14678
Cytogenetics 20p13
Domains Sm
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome, Systemic lupus erythematosus
Gene Summary The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.