FFAR3 (NM_005304) Human Tagged ORF Clone

CAT#: RG207772

FFAR3 (GFP-tagged) - Human free fatty acid receptor 3 (FFAR3)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FFAR3 (NM_005304) Human Tagged ORF Clone
Symbol FFAR3
Synonyms FFA3R; GPR41
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG207772 representing NM_005304
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATACAGGCCCCGACCAGTCCTACTTCTCCGGCAATCACTGGTTCGTCTTCTCGGTGTACCTTCTCA
CTTTCCTGGTGGGGCTCCCCCTCAACCTGCTGGCCCTGGTGGTCTTCGTGGGCAAGCTGCAGCGCCGCCC
GGTGGCCGTGGACGTGCTCCTGCTCAACCTGACCGCCTCGGACCTGCTCCTGCTGCTGTTCCTGCCTTTC
CGCATGGTGGAGGCAGCCAATGGCATGCACTGGCCCCTGCCCTTCATCCTCTGCCCACTCTCTGGATTCA
TCTTCTTCACCACCATCTATCTCACCGCCCTCTTCCTGGCAGCTGTGAGCATTGAACGCTTCCTGAGTGT
GGCCCACCCACTGTGGTACAAGACCCGGCCGAGGCTGGGGCAGGCAGGTCTGGTGAGTGTGGCCTGCTGG
CTGTTGGCCTCTGCTCACTGCAGCGTGGTCTACGTCATAGAATTCTCAGGGGACATCTCCCACAGCCAGG
GCACCAATGGGACCTGCTACCTGGAGTTCCGGAAGGACCAGCTAGCCATCCTCCTGCCCGTGCGGCTGGA
GATGGCTGTGGTCCTCTTTGTGGTCCCGCTGATCATCACCAGCTACTGCTACAGCCGCCTGGTGTGGATC
CTCGGCAGAGGGGGCAGCCACCGCCGGCAGAGGAGGGTGGCGGGGCTGTTGGCGGCCACGCTGCTCAACT
TCCTTGTCTGCTTTGGGCCCTACAACGTGTCCCATGTCGTGGGCTATATCTGCGGTGAAAGCCCGGCGTG
GAGGATCTACGTGACGCTTCTCAGCACCCTGAACTCCTGTGTCGACCCCTTTGTCTACTACTTCTCCTCC
TCCGGGTTCCAAGCCGACTTTCATGAGCTGCTGAGGAGGTTGTGTGGGCTCTGGGGCCAGTGGCAGCAGG
AGAGCAGCATGGAGCTGAAGGAGCAGAAGGGAGGGGAGGAGCAGAGAGCGGACCGACCAGCTGAAAGAAA
GACCAGTGAACACTCACAGGGCTGTGGAACTGGTGGCCAGGTGGCCTGTGCTGAAAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG207772 representing NM_005304
Red=Cloning site Green=Tags(s)

MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPF
RMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACW
LLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWI
LGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSS
SGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_005304
ORF Size 1038 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005304.2, NP_005295
RefSeq Size 1694
Locus ID 2865
Cytogenetics 19q13.12
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.