RYBP (NM_012234) Human Tagged ORF Clone

CAT#: RG206186

RYBP (tGFP-tagged) - Human RING1 and YY1 binding protein (RYBP)

Product Images

Circular map for RG206186

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: RYBP
• Synonyms: AAP1; APAP-1; DEDAF; YEAF1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG206186 representing NM_012234
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCATGGGCGACAAGAAGAGCCCGACCAGGCCAAAAAGACAAGCGAAACCTGCCACAGACGAAGGGT
  TTTGGGATTGTAGCGTCTGCACCTTCAGAAACAGTGCTGAAGCCTTTAAATGCAGCATCTGCGATGTGAG
  GAAAGGCACCTCCACCAGAAAACCTCGGATCAATTCTCAGCTGGTGGCACAACAAGTGGCACAACAGTAT
  GCCACCCCACCACCCCCTAAAAAGGAGAAGAAGGAGAAAGTTGAAAAGCAGGACAAAGAGAAACCTGAGA
  AAGACAAGGAAATTAGTCCTAGTGTTACCAAGAAAAATACCAACAAGAAAACCAAACCAAAGTCTGACAT
  TCTGAAAGATCCTCCTAGTGAAGCAAACAGCATACAGTCTGCAAATGCTACAACAAAGACCAGCGAAACA
  AATCACACCTCAAGGCCCCGGCTGAAAAACGTGGACAGGAGCACTGCACAGCAGTTGGCAGTAACTGTGG
  GCAACGTCACCGTCATTATCACAGACTTTAAGGAAAAGACTCGCTCCTCATCGACATCCTCATCCACAGT
  GACCTCCAGTGCAGGGTCAGAACAGCAGAACCAGAGCAGCTCGGGGTCAGAGAGCACAGACAAGGGCTCC
  TCCCGTTCCTCCACGCCAAAGGGCGACATGTCAGCAGTCAATGATGAATCTTTC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG206186 representing NM_012234
  Red=Cloning site Green=Tags(s)
  
  MTMGDKKSPTRPKRQAKPATDEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY
  ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSET
  NHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGS
  SRSSTPKGDMSAVNDESF
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_012234
• ORF Size: 684 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_012234.3, NP_036366.2
• RefSeq Size: 4562 bp
• RefSeq ORF: 687 bp
• Locus ID: 23429
• UniProt ID: Q8N488
• Cytogenetics: 3p13
• Domains: zf-RanBP
• Protein Families: Druggable Genome, Transcription Factors
• Gene Summary: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:25519132). Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites (By similarity). Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes (PubMed:19098711). May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis (PubMed:14765135, PubMed:27060496). May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1 (PubMed:11953439). May bind to DNA (By similarity). May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3 (PubMed:27748911).[UniProtKB/Swiss-Prot Function]