Aquaporin 5 (AQP5) (NM_001651) Human Tagged ORF Clone

CAT#: RG206069

Reviews ()
Write a review
  • TrueORF®

AQP5 (GFP-tagged) - Human aquaporin 5 (AQP5)



  "NM_001651" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Aquaporin 5 (AQP5) (NM_001651) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AQP5
Synonyms AQP-5; PPKB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG206069 representing NM_001651
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAAGGAGGTGTGCTCCGTGGCCTTCCTCAAGGCCGTGTTCGCAGAGTTCTTGGCCACCCTCATCT
TCGTCTTCTTTGGCCTGGGCTCGGCCCTCAAGTGGCCGTCGGCGCTGCCTACCATCCTGCAGATCGCGCT
GGCGTTTGGCCTGGCCATAGGCACGCTGGCCCAGGCCCTGGGACCCGTGAGCGGCGGCCACATCAACCCC
GCCATCACCCTGGCCCTCTTGGTGGGCAACCAGATCTCGCTGCTCCGGGCTTTCTTCTACGTGGCGGCCC
AGCTGGTGGGCGCCATTGCCGGGGCTGGCATCCTCTACGGTGTGGCACCGCTCAATGCCCGGGGCAATCT
GGCCGTCAACGCGCTCAACAACAACACAACGCAGGGCCAGGCCATGGTGGTGGAGCTGATTCTGACCTTC
CAGCTGGCACTCTGCATCTTCGCCTCCACTGACTCCCGCCGCACCAGCCCTGTGGGCTCCCCAGCCCTGT
CCATTGGCCTGTCTGTCACCCTGGGCCACCTTGTCGGAATCTACTTCACTGGCTGCTCCATGAACCCAGC
CCGCTCTTTTGGCCCTGCGGTGGTCATGAATCGGTTCAGCCCCGCTCACTGGGTTTTCTGGGTAGGGCCC
ATCGTGGGGGCGGTCCTGGCTGCCATCCTTTACTTCTACCTGCTCTTCCCCAACTCCCTGAGCCTGAGTG
AGCGTGTGGCCATCATCAAAGGCACGTATGAGCCTGACGAGGACTGGGAGGAGCAGCGGGAAGAGCGGAA
GAAGACCATGGAGCTGACCACCCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG206069 representing NM_001651
Red=Cloning site Green=Tags(s)

MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINP
AITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTF
QLALCIFASTDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGP
IVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001651
ORF Size 795 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001651.1, NP_001642.1
RefSeq Size 1316 bp
RefSeq ORF 798 bp
Locus ID 362
Cytogenetics 12q13.12
Protein Families Druggable Genome, Transmembrane
Gene Summary Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "AQP5"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Anti-AQP5 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools