Tumor protein D52 like 3 (TPD52L3) (NM_001001875) Human Tagged ORF Clone

CAT#: RG205471

TPD52L3 (tGFP-tagged) - Human tumor protein D52-like 3 (TPD52L3), transcript variant 3

Product Images

Circular map for RG205471

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Tumor protein D52 like 3
• Synonyms: D55; hD55; NYDSP25; TPD55
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG205471 representing NM_001001875
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCACATGCCAGGACAGAGACCTCTGTGGGCACATATGAATCCCACTCGACTTCTGAACTGGAGGATC
  TGACAGAGCCCGAGCAAAGAGAGCTCAAAACCAAACTCACTAAATTGGAGGCTGAAATTGTAACCCTACG
  CCACGTACTAGCAGCCAAAGAGAGACGCTGTGGGGAACTCAAGAGGAAGTTAGGCCTCACCGCCTTGGTA
  GGGCTGAGACAGAATCTGTCCAAGAGCTGGCTTGATGTTCAGGTCTCCAACACCTATGTGAAACAGAAGA
  CATCAGCTGCTCTGTCCACCATGGGCACTCTCATCTGCAGGAAGCTTGGAGGCGTGAAGAAGTCGGCCAC
  ACTCAGATCTTTTGAAGGAAACCCTAAAGGAGAAGGAAGCAGAATA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG205471 representing NM_001001875
  Red=Cloning site Green=Tags(s)
  
  MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALV
  GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001001875
• ORF Size: 396 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001001875.3, NP_001001875.1
• RefSeq Size: 1079 bp
• RefSeq ORF: 399 bp
• Locus ID: 89882
• UniProt ID: Q96J77
• Cytogenetics: 9p24.1
• Protein Families: Druggable Genome
• Gene Summary: This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]