CDR2 (NM_001802) Human Tagged ORF Clone

CAT#: RG204900

CDR2 (GFP-tagged) - Human cerebellar degeneration-related protein 2, 62kDa (CDR2)

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CDR2 (NM_001802) Human Tagged ORF Clone
Symbol CDR2
Synonyms CDR62; Yo
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG204900 representing NM_001802
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGCGGAAAACCTGGTAGAGGAGTTTGAGATGAAGGAGGACGAGCCGTGGTACGACCACCAGGACC
TCCAGCAAGATCTTCAACTTGCTGCTGAGCTTGGGAAGACATTACTGGATCGGAACACAGAGTTGGAGGA
CTCTGTTCAGCAGATGTATACAACCAATCAGGAGCAGTTACAGGAAATTGAGTATCTGACGAAGCAAGTG
GAACTTCTACGGCAGATGAACGAACAACATGCAAAGGTTTATGAACAATTAGACGTCACAGCAAGGGAAC
TGGAAGAAACAAATCAAAAGCTAGTTGCTGACAGCAAGGCCTCACAGCAAAAGATTCTGAGCCTGACTGA
AACGATTGAATGCCTGCAAACCAACATTGATCACCTCCAGAGCCAAGTGGAGGAGCTGAAGTCATCTGGC
CAAGGGAGAAGGAGCCCGGGAAAGTGTGACCAGGAGAAACCGGCACCCAGCTTTGCATGTCTGAAGGAGC
TGTATGACCTCCGCCAACACTTCGTGTATGATCATGTGTTCGCTGAGAAGATCACTTCCTTGCAAGGTCA
GCCAAGCCCTGATGAAGAGGAAAATGAGCACTTGAAAAAAACAGTGACAATGTTGCAGGCCCAGCTGAGC
CTGGAGCGGCAGAAGCGGGTGACTATGGAGGAGGAATATGGGCTCGTGTTAAAGGAGAACAGTGAACTGG
AGCAGCAGCTGGGGGCCACAGGTGCCTACCGAGCACGGGCGCTGGAACTAGAGGCCGAGGTGGCAGAGAT
GCGACAGATGTTGCAGTCAGAGCATCCATTTGTGAATGGAGTTGAGAAGCTGGTGCCAGACTCTCTGTAT
GTTCCTTTCAAAGAGCCCAGCCAGAGCCTGCTGGAAGAGATGTTCCTGACTGTGCCGGAATCACATAGAA
AGCCTCTCAAGCGCAGCAGCAGTGAGACGATCCTCAGCAGCTTGGCAGGGAGTGACATCGTGAAGGGCCA
CGAGGAGACCTGCATCAGGAGGGCCAAGGCTGTGAAACAGAGGGGCATCTCCCTTCTGCACGAAGTGGAC
ACGCAGTACAGCGCCCTGAAGGTGAAGTATGAAGAGTTGCTGAAGAAGTGCCAAGAGGAACAGGACTCCC
TGTCACACAAGGCTGTGCAGACCTCCAGGGCTGCAGCCAAGGACCTGACTGGAGTGAACGCCCAGTCTGA
GCCTGTTGCCAGCGGCTGGGAACTGGCCTCTGTCAACCCAGAGCCCGTGAGTTCCCCTACAACACCTCCA
GAATACAAAGCGTTGTTTAAGGAGATCTTTAGTTGCATCAAGAAAACTAAGCAGGAAATAGATGAACAGA
GAACAAAATACCGATCACTCTCCTCTCATTCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204900 representing NM_001802
Red=Cloning site Green=Tags(s)

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQV
ELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSG
QGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLS
LERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLY
VPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVD
TQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPP
EYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001802
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001802.1, NP_001793
RefSeq Size 2702
RefSeq ORF 1365
Locus ID 1039
Cytogenetics 16p12.2
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations