RRAS2 (NM_012250) Human Tagged ORF Clone

CAT#: RG204591

  • TrueORF®

RRAS2 (tGFP-tagged) - Human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_012250" in other vectors (5)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)
    • 100 ul

USD 625.00

Other products for "RRAS2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol RRAS2
Synonyms NS12; TC21
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG204591 representing NM_012250
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGGCCGGCTGGCGGGACGGCTCCGGCCAGGAGAAGTACCGGCTCGTGGTGGTCGGCGGGGGCG
GCGTGGGCAAGTCGGCGCTCACCATCCAGTTCATCCAGTCCTATTTTGTAACGGATTATGATCCAACCAT
TGAAGATTCTTACACAAAGCAGTGTGTGATAGATGACAGAGCAGCCCGGCTAGATATTTTGGATACAGCA
GGACAAGAAGAGTTTGGAGCCATGAGAGAACAGTATATGAGGACTGGCGAAGGCTTCCTGTTGGTCTTTT
CAGTCACAGATAGAGGCAGTTTTGAAGAAATCTATAAGTTTCAAAGACAGATTCTCAGAGTAAAGGATCG
TGATGAGTTCCCAATGATTTTAATTGGTAATAAAGCAGATCTGGATCATCAAAGACAGGTAACACAGGAA
GAAGGACAACAGTTAGCACGGCAGCTTAAGGTAACATACATGGAGGCATCAGCAAAGATTAGGATGAATG
TAGATCAAGCTTTCCATGAACTTGTCCGGGTTATCAGGAAATTTCAAGAGCAGGAATGTCCTCCTTCACC
AGAACCAACACGGAAAGAAAAAGACAAGAAAGGCTGCCATTGTGTCATTTTC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG204591 representing NM_012250
Red=Cloning site Green=Tags(s)

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA
GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE
EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012250
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012250.6
RefSeq Size 1510 bp
RefSeq ORF 615 bp
Locus ID 22800
UniProt ID P62070
Cytogenetics 11p15.2
Domains ras, RAN, RAS, RHO, RAB
Protein Families Druggable Genome
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction
Gene Summary This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.