SDOS (NUDT16L1) (NM_032349) Human Tagged ORF Clone

CAT#: RG202638

  • TrueORF®

NUDT16L1 (tGFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 (NUDT16L1), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_032349" in other vectors (4)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit Polyclonal Anti-NUDT16L1 Antibody
    • 100 ul

USD 539.00

Other products for "SDOS"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SDOS
Synonyms SDOS; TIRR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG202638 representing NM_032349
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGACGGCGGCGGTTCCGGAGCTGAAGCAGATCAGCCGGGTGGAGGCGATGCGCCTAGGGCCGGGCT
GGAGCCACTCGTGCCACGCCATGCTGTACGCCGCCAACCCTGGGCAGCTCTTCGGCCGCATCCCCATGCG
CTTCTCGGTGCTGATGCAGATGCGTTTCGACGGGCTGCTGGGCTTCCCCGGGGGCTTCGTGGACCGGCGC
TTCTGGTCGCTGGAGGACGGCCTGAACCGGGTGCTGGGCCTGGGCCTGGGCTGCCTGCGCCTCACCGAGG
CCGACTACCTGAGCTCGCACCTGACCGAGGGCCCACACCGCGTCGTGGCGCACCTGTACGCGCGGCAGCT
GACGCTGGAGCAGCTGCACGCCGTGGAGATCAGCGCGGTGCACTCGCGCGACCACGGCCTGGAGGTGCTG
GGCCTCGTGCGGGTCCCGCTGTACACCCAGAAGGACCGAGTCGGAGGCTTCCCCAACTTCCTGAGCAACG
CCTTCGTGAGCACGGCTAAGTGCCAGCTCCTCTTTGCCCTCAAGGTGCTCAACATGATGCCCGAGGAGAA
GCTGGTTGAGGCCCTGGCTGCAGCCACCGAGAAGCAGAAGAAGGCCCTGGAGAAGTTGCTCCCGGCCTCC
TCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202638 representing NM_032349
Red=Cloning site Green=Tags(s)

MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRR
FWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVL
GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPAS
S

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032349
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032349.3
RefSeq Size 1341 bp
RefSeq ORF 636 bp
Locus ID 84309
UniProt ID Q9BRJ7
Cytogenetics 16p13.3
Gene Summary Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin (PubMed:28241136). In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus (PubMed:28241136). Following DNA damage, ATM-induced phosphorylation of TP53BP1 and subsequent recruitment of RIF1 leads to dissociate NUDT16L1/TIRR from TP53BP1, unmasking the tandem Tudor-like domain and allowing recruitment of TP53BP1 to DNA double strand breaks (DSBs) (PubMed:28241136). Binds U8 snoRNA (PubMed:18820299).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.