Rps6kb1 (NM_028259) Mouse Tagged ORF Clone

CAT#: MG227040

  • TrueORF®

Rps6kb1 (tGFP-tagged) - Mouse ribosomal protein S6 kinase polypeptide 1 (Rps6kb1) transcript variant 2, (10ug)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_028259" in other vectors (4)

Reconstitution Protocol

USD 530.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


RPS6KB1 Antibody - middle region
    • 100 ul

USD 539.00

Other products for "Rps6kb1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Rps6kb1
Synonyms 70kDa; 2610318I15Rik; 4732464A07Rik; AA959758; AI256796; AI314060; p70/85s6k; p70s6k; S6K1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG227040 representing NM_028259
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCGACGACGGAGGCGGGACGGCTTTTACCTAGCGCCTGACTTCCGACACAGGGAAGCTGAGGACA
TGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAAGATGCAGGCTCTGAGGATGAGCTGGAGGAGGG
GGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAG
AAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTAC
TTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGTTTTTCAAGTACGAAAAGTAACAGGAGCAAATACTGG
GAAGATATTTGCCATGAAGGTGCTTAAAAAGGCAATGATAGTGAGGAATGCTAAGGACACGGCCCACACG
AAAGCAGAGCGGAACATTCTGGAGGAAGTGAAACACCCTTTCATTGTGGACCTGATTTATGCCTTTCAGA
CCGGAGGAAAGCTCTACCTCATCCTCGAGTATCTCAGTGGAGGAGAACTATTTATGCAGTTAGAAAGAGA
GGGAATATTCATGGAAGACACAGCGTGGCCTTGGGTGGACCGCTCTTCACTGCAGAATTTCCTTGAATTG
ACTTTCCAGTTCCCAAGGTGCAGTCTTAGGGAGGTGATAACCCTGAACATACATCTGTGGATTGATTTTA
TAGCCAGGATGGGATCTGCCCTCCTATTCGCCTTTTCTAACACAGAAGCTGCATTTAAGAGCCTTAGGGA
TGAAGTGCCCCTTTTTGGAGGAGGCTCTCTGAGCCCTGTGGAGGCTGTGGTCCTGCTAGCTGTGAAACTG
CCTCAGTCCTCTAGGACACACCCTCCATCCTGGAGTAATCTGCAGGATTGCAACATTGTTACACAGCCAG
TATTGCAGTGCTTTGTGCTTTTCGAATCCAGACAGGGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG227040 representing NM_028259
Red=Cloning site Green=Tags(s)

MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCE
KFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHT
KAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTAWPWVDRSSLQNFLEL
TFQFPRCSLREVITLNIHLWIDFIARMGSALLFAFSNTEAAFKSLRDEVPLFGGGSLSPVEAVVLLAVKL
PQSSRTHPPSWSNLQDCNIVTQPVLQCFVLFESRQG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_028259
ORF Size 948 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_028259.4, NP_082535.1
RefSeq Size 3283 bp
RefSeq ORF 951 bp
Locus ID 72508
Cytogenetics 11 C
Gene Summary Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression. Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex. Upon mitogenic stimulation, phosphorylation by the mammalian target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation. The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B. Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis. Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR. In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2. Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling. Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function. Phosphorylates mitochondrial RMP leading to dissociation of a RMP:PPP1CC complex. The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. May be involved in cytoskeletal rearrangement through binding to neurabin. Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR (By similarity) (PubMed:11493700, PubMed:11500364, PubMed:15060135, PubMed:18952604). Following activation by mTORC1, phosphorylates EPRS and thereby plays a key role in fatty acid uptake by adipocytes and also most probably in interferon-gamma-induced translation inhibition (PubMed:28178239).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.