S100a4 (NM_011311) Mouse Tagged ORF Clone

CAT#: MG225750

S100a4 (tGFP-tagged) - Mouse S100 calcium binding protein A4 (S100a4), (10ug)

Product Images

Circular map for MG225750

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: S100a4
• Synonyms: 18A2; 42a; Capl; FSp1; metastasin; Mts1; PeL98; pk9a
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG225750 representing NM_011311
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAAGACCCTTGGAGGAGGCCCTGGATGTAATTGTGTCCACCTTCCACAAATACTCAGGCAAAGAGG
  GTGACAAGTTCAAGCTGAACAAGACAGAGCTCAAGGAGCTACTGACCAGGGAGCTGCCTAGCTTCCTGGG
  GAAAAGGACAGATGAAGCTGCATTCCAGAAGGTGATGAGCAACTTGGACAGCAACAGGGACAATGAAGTT
  GACTTCCAGGAGTACTGTGTCTTCCTGTCCTGCATTGCCATGATGTGCAATGAATTCTTTGAGGGCTGCC
  CAGATAAGGAGCCCCGGAAGAAG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG225750 representing NM_011311
  Red=Cloning site Green=Tags(s)
  
  MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEV
  DFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_011311
• ORF Size: 303 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_011311.2, NP_035441.1
• RefSeq Size: 513 bp
• RefSeq ORF: 306 bp
• Locus ID: 20198
• UniProt ID: P07091
• Cytogenetics: 3 39.27 cM
• Gene Summary: Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy (PubMed:20519440). Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9 (PubMed:8051043). Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis (PubMed:8051043). Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels (By similarity). Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes (PubMed:20103644). In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors (By similarity).[UniProtKB/Swiss-Prot Function]