Abcc3 (NM_029600) Mouse Tagged ORF Clone

CAT#: MG224428

Reviews ()
Write a review
  • TrueORF®

Abcc3 (GFP-tagged) - Mouse ATP-binding cassette sub-family C (CFTR/MRP) member 3 (Abcc3), (10ug)



  "NM_029600" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,502.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Other products for "Abcc3"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Abcc3
Synonyms 1700019L09Rik; ABC31; MLP2; MOAT-D; MRP3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG224428 representing NM_029600
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCGCCTGTGCGGCTCCGGAGAGCTGGGCTCCAAGTTCTGGGACTCCAACCTGTCTATATATACCA
ACACTCCGGACCTCACACCCTGTTTCCAGAACTCCTTGCTGGCCTGGGTCCCCTGCATCTACCTGTGGGC
TGCCTTGCCCTGCTACCTGTTTTACCTGAGACACCATCAGCTCGGCTACATAGTCCTCTCATGGTTATCC
AGGCTCAAGACGGCCCTCGGTGTTCTGCTGTGGTGTGTCTCATGGGTGGACCTGTTCTATTCCTTCCACG
GCCTGATCCATGGCTCATCCCCTGCTCCTGTCTTCTTTGTCACACCCTTGGTGGTGGGGATCACCATGCT
GCTGGCCACTTTGCTAATCCAGTACGAGCGGCTTCGGGGGGTGCAGTCTTCGGGAGTGCTCATCATATTC
TGGCTCCTGTGTGTGATCTGTGCCATCATCCCCTTCCGTTCCAAGATCCTCTCAGCTTTGGCAGAGGGTA
AAATCTTGGATCCGTTCCGGTTCACCACTTTCTACATCTACTTTGCCCTGGTGTTCTGTGCCCTCATCCT
GTCCTGCTTCAAGGAGAAGCCGCCTTTGTTCTCCCCGGAGAATCTTGACACAAATCCTTGCCCAGAGGCC
AGCGCTGGCTTCTTTTCCCGCTTGTCTTTCTGGTGGTTCACAAGGCTTGCCATCCTTGGCTACCGACGTC
CCCTGGAGGACCGTGACCTCTGGTCTCTGTCTGAGGAGGACTGCTCTCACAAGGTGGTACAACGGCTGCT
GGAAGCATGGCAAAAGCAGCAGAACCAAGCATCAGGGTCCCAGACGGCAACAGCTGAGCCAAAGATCCCA
GGTGAGGATGCGGTCCTACTGAAGCCCCGACCCAAGTCCAAGCAGCCTTCCTTTCTGAGGGCTTTGGTGA
GAACCTTCACCTCCAGCTTGCTCATGAGTGCCTGCTTCAACCTGATCCAGAACCTACTCGGCTTCGTCAA
CCCACAGCTGCTCAGTATACTCATCAGGTTTATTTCTGACCCCACGGCCCCCACCTGGTGGGGCTTCTTG
CTGGCCGGACTGATGTTCCTGAGCTCCACCATGCAGACATTGATCTTACACCAATATTACCACTGCATCT
TTGTGATGGCCTTGAGGCTACGGACTGCTATTATAGGTGTCATCTACAGGAAGGCTCTGGTCATCACCAA
CTCAGTCAAACGGGAGTCCACTGTGGGAGAAATGGTCAACCTCATGTCAGTGGATGCTCAGCGCTTCATG
GATGTCTCCCCTTTCATCAATCTGCTGTGGTCTGCACCTTTGCAGGTCATCCTGGCAATATACTTCCTCT
GGCAGATCCTGGGCCCATCAGCTCTGGCTGGAGTGGCTGTGATAGTCTTGCTGATACCACTCAATGGAGC
TGTGTCCATGAAGATGAAGACCTACCAGGTAAAGCAAATGAAGTTCAAGGACTCCCGCATCAAGCTGATG
AGCGAGATCCTGAACGGCATCAAAGTGCTCAAGCTGTACGCTTGGGAGCCCAGCTTCTTGGAGCAGGTGA
AAGGGATCAGGCAGAGTGAACTTCAGCTGCTCCGGAAGGGGGCCTACCTGCAGGCCATCTCCACCTTCAT
CTGGATCTGCACCCCATTTCTGGTGACCCTGATCACCCTCGGAGTGTACGTGTATGTGGACGAGAGCAAT
GTACTGGATGCCGAGAAGGCCTTTGTGTCCCTGTCTTTGTTCAATATCTTAAAGATCCCCCTCAACATGC
TGCCTCAGTTAATCAGTGGACTGACCCAGGCCAGCGTGTCTCTGAAACGGATCCAGGATTTCCTGAACCA
AAATGAACTTGACCCCCAATGTGTGGAAAGAAAGACCATCTCCCCAGGCTACGCCATCACCATACACAAC
GGCACCTTCACCTGGGCCCAGGACCTGCCGCCCACCCTGCACAGCCTAAACATTCAAATCCCGAAGGGGG
CGTTGGTGGCTGTGGTGGGACCTGTGGGCTGTGGGAAGTCTTCTCTGGTGTCTGCCTTACTCGGAGAGAT
GGAGAAGCTGGAAGGTGTGGTGTCTGTAAAGGGCTCTGTGGCCTACGTGCCCCAGCAGGCATGGATCCAG
AACTGCACACTTCAGGAAAATGTGCTATTTGGCCAACCCATGAACCCCAAGCGCTACCAACAGGCTCTGG
AGACATGTGCCCTGCTAGCTGACCTAGATGTGCTTCCTGGTGGGGACCAGACAGAGATTGGAGAGAAGGG
TATTAACCTATCTGGAGGCCAGCGCCAACGGGTGAGTTTGGCCCGAGCTGTTTATAGTGATGCCAACATT
TTTTTGCTGGATGACCCACTGTCGGCTGTGGACTCTCATGTGGCGAAGCATATCTTCGACCAAGTGATTG
GACCAGAAGGTGTGCTGGCAGGCAAGACTCGGGTGCTGGTAACTCATGGCATCAGCTTCCTGCCCCAGAC
GGACTTTATCATTGTGCTTGCTGGTGGACAGGTGTCTGAGATGGGCCACTACTCGGCCCTCCTGCAGCAT
GATGGCTCCTTTGCCAACTTCCTCCGAAACTACGCACCAGATGAAGACCAGGAGGACCATGAAGCAGCCT
TGCAAAATGCAAATGAGGAGGTACTCCTGCTCGAAGACACACTCAGCACCCACACAGACCTGACAGACAA
TGAGCCAGCCATCTACGAGGTCCGCAAGCAGTTCATGAGAGAGATGAGCTCCTTGTCTTCTGAAGGGGAG
GTCCAGAACCGGACTATGCCCAAGAAACACACAAATTCATTGGAGAAGGAGGCGCTGGTGACAAAGACTA
AGGAGACTGGCGCATTAATCAAAGAGGAGATAGCAGAGACAGGCAATGTGAAGCTGAGTGTGTACTGGGA
TTATGCCAAGTCTATGGGACTCTGTACCACGCTATCTATCTGCCTCCTGTATGGTGGCCAAAGCGCAGCT
GCTATCGGAGCCAATGTGTGGCTCAGCGCCTGGAGCAATGATGCGGAGGAACATGGCCAGCAGAACAAGA
CCTCCGTAAGGCTCGGTGTCTACGCCGCCCTAGGGATACTGCAAGGGCTCCTGGTCATGTTGTCAGCTTT
CACCATGGTGGTCGGCGCGATCCAGGCTGCCCGCCTGCTGCACGAAGCTCTGCTGCACAACAAGATTCGT
TCCCCTCAGTCCTTCTTTGACACCACGCCCTCGGGCCGCATCCTCAACCGTTTCTCCAAGGACATATACG
TCATCGACGAGGTTCTGGCCCCCACCATCCTCATGCTGTTGAATTCCTTCTTCACATCCATCTCCACCAT
CATGGTCATCGTGGCCAGCACGCCGCTCTTCATGGTGGTTGTCTTGCCCCTGGCTGTGCTCTATGGCTTT
GTGCAGCGCTTCTATGTGGCCACATCACGGCAGCTCAAGCGGCTGGAATCCATCAGCCGCTCACCCATCT
TCTCCCACTTTTCGGAGACAGTAACGGGCACCAGTGTCATTCGGGCCTATGGCCGAATCCAAGACTTCAA
GGTCCTCAGTGATACTAAGGTGGACAACAACCAGAAAAGCAGTTATCCCTACATTGCCTCCAATCGATGG
CTGGGGGTCCACGTGGAGTTTGTGGGGAACTGCGTGGTGCTCTTTGCCGCACTGTTTGCAGTGATCGGGA
GAAACAGCTTGAATCCAGGGCTTGTGGGTCTTTCTGTGTCCTATGCCTTACAGGTGACCATGGCTTTGAA
TTGGATGATACGAATGATATCCGACTTGGAGTCTAATATCATAGCTGTGGAGAGAGTCAAGGAGTACTCT
AAGACCAAGACTGAGGCCCCCTGGGTGGTGGAGAGCAACCGCGCCCCGGAAGGCTGGCCCACGCGAGGAA
TGGTGGAGTTCCGGAACTATTCAGTGCGGTACCGGCCTGGCCTCGAGTTGGTGCTGAAGAACGTGACTGT
TCATGTGCAGGGTGGGGAGAAGGTAGGCATTGTGGGCCGCACTGGGGCTGGCAAATCTTCCATGACTCTT
TGCCTGTTCCGAATCCTGGAGGCCGCAGAGGGTGAGATCGTCATTGATGGGCTCAACGTGGCACACATTG
GCCTCCACGACCTGCGCTCTCAGCTCACCATCATCCCTCAGGACCCCATCCTGTTCTCGGGCACCCTGCG
TATGAACTTAGATCCCTTTGGCCGATACTCGGAGGAGGACATCTGGAGGGCCCTGGAGCTATCCCACCTG
AACACGTTCGTGAGCAGCCAGCCAGCAGGCCTGGATTTCCAGTGCGCTGAGGGTGGGGATAATCTCAGTG
TTGGCCAGAGGCAGCTTGTATGCCTAGCCCGAGCCCTGCTCCGGAAGAGCCGAGTCCTGGTTTTAGACGA
GGCCACTGCTGCCATTGACTTGGAGACGGATGACCTCATCCAGGGCACCATCCGTACCCAGTTTGAAGAC
TGCACCGTACTGACCATCGCCCACCGGCTCAACACAATCATGGACTACAACAGGGTCCTGGTCTTGGACA
AAGGAGTAGTAGCTGAATTTGATTCTCCAGTCAACCTCATTGCGGCCGGAGGCATCTTCTATGGGATGGC
CAAGGATGCGGGACTTGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG224428 representing NM_029600
Red=Cloning site Green=Tags(s)

MDRLCGSGELGSKFWDSNLSIYTNTPDLTPCFQNSLLAWVPCIYLWAALPCYLFYLRHHQLGYIVLSWLS
RLKTALGVLLWCVSWVDLFYSFHGLIHGSSPAPVFFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIF
WLLCVICAIIPFRSKILSALAEGKILDPFRFTTFYIYFALVFCALILSCFKEKPPLFSPENLDTNPCPEA
SAGFFSRLSFWWFTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQKQQNQASGSQTATAEPKIP
GEDAVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFL
LAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFM
DVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLM
SEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESN
VLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYAITIHN
GTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQ
NCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANI
FLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAGGQVSEMGHYSALLQH
DGSFANFLRNYAPDEDQEDHEAALQNANEEVLLLEDTLSTHTDLTDNEPAIYEVRKQFMREMSSLSSEGE
VQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAA
AIGANVWLSAWSNDAEEHGQQNKTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIR
SPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGF
VQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRW
LGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYS
KTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTL
CLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHL
NTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFED
CTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIAAGGIFYGMAKDAGLA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_029600
ORF Size 4566 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_029600.3, NP_083876.3
RefSeq Size 5002 bp
RefSeq ORF 4569 bp
Locus ID 76408
UniProt ID B2RX12
Cytogenetics 11 D
Gene Summary May act as an inducible transporter in the biliary and intestinal excretion of organic anions. Acts as an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.