Dio3 (NM_172119) Mouse Tagged ORF Clone

CAT#: MG223143

Dio3 (GFP-tagged) - Mouse deiodinase iodothyronine type III (Dio3), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Product Images

Circular map for MG223143

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Symbol: Dio3
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG223143 representing NM_172119
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCTCGCCAGGCCGCCTCGAGGTTGGTGGTCGGAGAAGGTGAAGGGCCCCCGGGGGCTTCGGGGCCCG
  CGGCCACCATGCTCCGCTCTCTGCTGCTTCACTCGCTGAGGCTCTGCGCCCAGACCGCCTCGTGCCTCGT
  GCTGTTCCCGCGCTTCCTAGGCACGGCCTTCATGCTCTGGCTTTTAGATTTCTTGTGCATCCGCAAGCAT
  TTCCTGCGCCGTCGCCATCCTGACCACCCTGAGCCCGAAGTAGAGCTCAACAGTGAAGGCGAGGAGATGC
  CCCCTGACGACCCGCCCATATGCGTATCAGACGACAACCGTCTGTGCACCCTGGCCTCTCTCAAAGCCGT
  GTGGCATGGCCAGAAATTGGATTTCTTCAAGCAAGCCCATGAGGGTGGCCCAGCGCCCAACTCGGAGGTT
  GTCCGACCTGATGGCTTCCAGAGCCAGCGCATCCTCGACTACGCACAAGGGACCCGCCCGTTGGTGCTCA
  ATTTTGGCAGCTGTACCTGACCACCGTTCATGGCGCGGATGAGCGCCTTCCAGCGCCTGGTCACCAAGTA
  CCAGCGCGACGTTGACTTCCTTATCATCTACATCGAGGAAGCCCACCCATCCGACGGCTGGGTCACCACA
  GATTCACCCTATGTCATCCCCCAGCACCGCAGCCTGGAGGACCGTGTCAGCGCAGCGAGAGTACTACAAC
  AAGGTGCACCTGGCTGTGCTCTGGTCCTGGACACTATGGCCAACTCTAGCAGTTCCGCATATGGTGCCTA
  TTTTGAGCGCCTCTACGTCATCCAGAGTGGCACCATCATGTACCAGGGAGGCCGTGGCCCCGACGGTTAC
  CAGGTGTCTGAGTTGCGCACTTGGTTGGAGCGCTATGATGAACAGTTGCATGGTACTAGGCCACATCGAT
  TC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG223143 representing NM_172119
  Red=Cloning site Green=Tags(s)
  
  MPRQAASRLVVGEGEGPPGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKH
  FLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEV
  VRPDGFQSQRILDYAQGTRPLVLNFGSCT*PPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTT
  DSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGY
  QVSELRTWLERYDEQLHGTRPHRF
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_172119
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_172119.2, NP_742117.2
• RefSeq Size: 1872 bp
• RefSeq ORF: 915 bp
• Locus ID: 107585
• UniProt ID: Q91ZI8
• Cytogenetics: 12 F1
• Gene Summary: This is an intronless, imprinted gene that is preferentially expressed from the paternal allele in the mouse fetus. The encoded protein belongs to the iodothyronine deiodinase family, and catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3,3',5-triiodothyronine (T3) to inactive metabolites, 3,3',5' triiodothyronine (RT3) and 3,3'-diiodothyronine (T2), respectively. It is highly expressed in placenta, fetal and neonatal tissues, and thought to prevent premature exposure of developing fetal tissues to adult levels of thyroid hormones. It thus plays a critical role in mammalian development by regulating circulating fetal thyroid hormone concentration. Knockout mice lacking this gene exhibit severe abnormalities related to development and reproduction. This protein is a selenoprotein, containing the rare selenocysteine (Sec) amino acid at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jun 2016]