Acot11 (NM_025590) Mouse Tagged ORF Clone

CAT#: MG209248

Acot11 (GFP-tagged) - Mouse acyl-CoA thioesterase 11 (Acot11)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 824.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Acot11 (NM_025590) Mouse Tagged ORF Clone
Symbol Acot11
Synonyms 1110020M10Rik; 2010309H15Rik; AW060409; BFIT; BFIT1; mKIAA0707; Thea; Them1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG209248 representing NM_025590
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTCAGAATGTGGGCAACCACTTGCGAAGGGGCTTCGCCTCTATGTTCTCTAATCGCACATCCCGGA
AGTCAATCTCCCATCCGGAGTCTGGAGACCCTCCTACCATGGCAGAGGGTGAAGGATACCGGAACCCCAC
GGAGGTGCAGATGAGCCAGCTGGTACTGCCCTGCCACACCAACCACCGTGGGGAGCTGAGCATTGGACAG
TTGCTCAAGTGGATCGACACCACAGCCTGCCTATCAGCGGAGAGGCATGCTGGCTGTCCCTGCGTCACAG
CCTCTATGGATGACATCTACTTCGACCATACCATTAGTGTCGGCCAAGTGGTGAATATCAAGGCCAAGGT
GAACCGGGCCTTCAACTCCAGCATGGAGGTGGGAATCCAGGTGGTCTCTGAGGATCTGTGCTCTGAGAAG
CAGTGGAGTGTCTGCAAGGCCTTGGCCACCTTTGTGGCCCACCGGGAGCTCTCCAAGGTGAAGCTGAAGC
AGGTCATCCCATTGACCGAGGAGGAGAAGACTGAACATGGGGTGGCGGCTGAGCGCCGGCGTATGCGACT
GGTCTATGCAGACACCATCAAAGATCTCCTAACCCACTGTGTCATCCAGGACGATTTGGACAAGGACTGC
AGCAATATGGTGCCAGCCGAGAAGACCCGAGTGGAGAGTGTGGAGCTGGTGCTGCCTCCTCACGCCAATC
ATCAGGGCAATACCTTCGGGGGACAGATCATGGCTTGGATGGAGAATGTGGCCACCATTGCAGCCAGCCG
GCTCTGTCACGCCCACCCTACGCTCAAGGCCATCGAGATGTTCCATTTCCGAGGCCCGTCTCAGGTGGGG
GACCGTCTGGTGCTCAAGGCCATCGTGAATAACGCCTTTAAGCACAGCATGGAGGTGGGTGTGTGTGTGG
AGGCGTACCGCCAGGAAGCTGAGACCCAGCGCCGGCACATCAACAGCGCCTTCATGACCTTCGTGGTCCT
GGACAAAGATGACCAGCCTCAGAAGCTGCCCTGGATTCGTCCCCAGCCTGGAGAGGGTGAACGGCGATAC
CGAGAAGCCAGTGCCAGGAAGAAGATCCGCCTGGACAGGAAATACCTTGTGTCCTGTAAGCAGGCAGAAG
TGGCCCTGTCTGTCCCCTGGGACCCTAGCAACCAGGTATACCTGAGCTACTACAACGTGTCCTCTCTGAA
GACGCTCATGGCCAAGGACAACTGGGTGCTGTCCGTGGAGATCAGCGAGGTCCGCCTGTACATCCTAGAA
GAGGACTTCCTCTCCTTTCACTTGGAGATGGTGGTAAATGTGGATGCCGCCCAGGTCTTTCAGCTGCTGT
CAGACCTGCGCAGGAGACCAGAGTGGGACAAGCATTACCGGAGTGTGGAGCTGGTGCAGCAAGTGGATGA
GGATGACGCCATCTACCACGTCATCAGCCCCGCCCTGAGCGGGAACACCAAGCCCCAGGACTTTGTGATC
CTGGCCTCTAGGCGGAAGCCTTGTGACAATGGGGACCCCTATGTCATTGCCCTGAGGTCGGTCACGCTGC
CCACGCACCATGAGACACCGGAATACCAACGTGGGGAGACTCTCTGTTCAGGCTTCTGTCTGTGGCGTGA
GGGGGACCAGATGACTAAGGTTTCTTACTACAACCAGGCCACCCCCGGCTTTCTCAACTATGTGACCACC
AATGTGTCCGGCCTGTCCTCAGAATTCTACAACACTTTCAAGGCTTGTGAGAGTTTTCTGTTGGACAACC
GGAATGACCTAGCTCCCAGCCTCCAGACCCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG209248 representing NM_025590
Red=Cloning site Green=Tags(s)

MIQNVGNHLRRGFASMFSNRTSRKSISHPESGDPPTMAEGEGYRNPTEVQMSQLVLPCHTNHRGELSIGQ
LLKWIDTTACLSAERHAGCPCVTASMDDIYFDHTISVGQVVNIKAKVNRAFNSSMEVGIQVVSEDLCSEK
QWSVCKALATFVAHRELSKVKLKQVIPLTEEEKTEHGVAAERRRMRLVYADTIKDLLTHCVIQDDLDKDC
SNMVPAEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCHAHPTLKAIEMFHFRGPSQVG
DRLVLKAIVNNAFKHSMEVGVCVEAYRQEAETQRRHINSAFMTFVVLDKDDQPQKLPWIRPQPGEGERRY
REASARKKIRLDRKYLVSCKQAEVALSVPWDPSNQVYLSYYNVSSLKTLMAKDNWVLSVEISEVRLYILE
EDFLSFHLEMVVNVDAAQVFQLLSDLRRRPEWDKHYRSVELVQQVDEDDAIYHVISPALSGNTKPQDFVI
LASRRKPCDNGDPYVIALRSVTLPTHHETPEYQRGETLCSGFCLWREGDQMTKVSYYNQATPGFLNYVTT
NVSGLSSEFYNTFKACESFLLDNRNDLAPSLQTL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_025590
ORF Size 1782 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025590.3, NP_079866
RefSeq Size 5668
RefSeq ORF 1785
Locus ID 329910
Cytogenetics 4|4 C7
Gene Summary Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)