Cdc25b (BC057568) Mouse Tagged ORF Clone

CAT#: MG208736

  • TrueORF®

Cdc25b (GFP-tagged) - Mouse cell division cycle 25 homolog B (S. pombe) (cDNA clone MGC:66900 IMAGE:6401489)

USD 800.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Cdc25b (BC057568) Mouse Tagged ORF Clone
Symbol Cdc25b
Vector pCMV6-AC-GFP
Sequence Data
>MG208736 representing BC057568
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTACCCCTGCAGAAGTCTGCGCCGGGTTCAGCTCTCAGTCCTGCCCGCGTGCTGGGTGGCATTC
AGCGGCCGCGCCACCTCTCGGTCTTTGAGTTTGAGTCTGATGGCTTCCTGGGGTCTCCGGAGCCTACAGC
TTCCTCCTCTCCGGTTACCACTCTTACACAGACCATGCACAACCTCGCTGGGCTCGGCAGTGAGCCTCCA
AAAGCTCAAGTAGGAAGCCTGTCGTTCCAGAACAGGCTGGCAGACCTATCCCTGTCCAGGCGCACCTCTG
AGTGCTCCCTGTCATCTGAGTCCTCAGAATCTTCGGATGCAGGTCTGTGCATGGACTCCCCCAGCCCTGT
GGACCCGCAGATGGCAGAGCGCACGTTTGAACAGGCCATTCAGGCAGCCAGTCGGGTCATTCAAAATGAG
CAGTTTACCATAAAACGCTTCCGATCCTTACCAGTGAGGCTGCTGGAACACAGTCCGGTGCTGCAGAGCA
TCACCAACTCCCGAGCACTGGACAGCTGGAGGAAAACTGAAGCAGGCTACCGAGCCGCCGCCAATAGTCC
TGGGGAGGACAAAGAGAATGTGCGCTTCCAGAGACCAAGATGGAGGAGCTCCAGGGAGAGAAGGTGTCTT
ACCACTGAGTGGAAGATGGAAGTAGAGGAGCTGAGCCCGGTGGCACAGTCTTCTTCCTTGACTCCTGTCG
AAAGGGCTTCTGAAGAAGATGACGGATTTGTGGACATCCTGGAGAGTGATTTAAAGGATGACGAGAAGGT
CCCCGCGGGCATGGAGAACCTCATTAGTGCCCCACTGGTCAAAAAGCTGGATAAGGAAGAGGAACAGGAT
CTCATCATGTTCAGCAAGTGCCAGAGGCTCTTCCGCTCCCCATCCATGCCATGCAGTGTGATCCGACCCA
TCCTCAAGAGGCTAGAGCGGCCCCAGGACCGGGATGTGCCTGTCCAGAGCAAGCGCAGGAAAAGTGTGAC
ACCCCTGGAAGAGCAGCAGCTTGAAGAACCTAAGGCCCGTGTCTTTCGCTCAAAGTCGCTGTGTCATGAG
ATTGAGAACATCCTGGATAGTGACCACCGTGGACTGATCGGAGATTACTCTAAGGCCTTCCTCCTGCAGA
CCGTGGATGGCAAACACCAAGACCTTAAGTACATCTCACCAGAAACTATGGTGGCCCTGTTAACAGGCAA
GTTCAGCAACATCGTGGAGAAATTTGTCATTGTGGACTGCAGATACCCCTATGAGTATGAAGGCGGGCAT
ATCAAGAATGCTGTGAACCTGCCCCTGGAACGGGATGCTGAGACCTTTCTGCTGCAGCGTCCCATCATGC
CTTGTAGCCTGGACAAGAGAATCATCCTCATTTTCCACTGTGAATTCTCGTCTGAGCGTGGACCACGAAT
GTGCCGCTTCATCAGGGAACGGGACCGTGCAGCTAACGACTACCCCAGCCTGTACTACCCGGAGATGTAC
ATCCTCAAAGGCGGCTACAAGGAGTTCTTCCCACAGCATCCGAACTTTTGTGAGCCCCAGGACTACCGAC
CCATGAACCACGAGGCTTTCAGGGATGAGCTGAGGAACTTTCGCCTTAAGACTCGCAGCTGGGCTGGGGA
ACGGAGCAGGAGGGAACTTTGTAGCAGGCTGCAAGACCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG208736 representing BC057568
Red=Cloning site Green=Tags(s)

MEVPLQKSAPGSALSPARVLGGIQRPRHLSVFEFESDGFLGSPEPTASSSPVTTLTQTMHNLAGLGSEPP
KAQVGSLSFQNRLADLSLSRRTSECSLSSESSESSDAGLCMDSPSPVDPQMAERTFEQAIQAASRVIQNE
QFTIKRFRSLPVRLLEHSPVLQSITNSRALDSWRKTEAGYRAAANSPGEDKENVRFQRPRWRSSRERRCL
TTEWKMEVEELSPVAQSSSLTPVERASEEDDGFVDILESDLKDDEKVPAGMENLISAPLVKKLDKEEEQD
LIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRKSVTPLEEQQLEEPKARVFRSKSLCHE
IENILDSDHRGLIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVEKFVIVDCRYPYEYEGGH
IKNAVNLPLERDAETFLLQRPIMPCSLDKRIILIFHCEFSSERGPRMCRFIRERDRAANDYPSLYYPEMY
ILKGGYKEFFPQHPNFCEPQDYRPMNHEAFRDELRNFRLKTRSWAGERSRRELCSRLQDQ

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC057568
ORF Size 1652 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC057568
RefSeq Size 2935
RefSeq ORF 1652
Locus ID 12531
Cytogenetics 2 F1|2 63.29 cM
Other products for "Cdc25b"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies