Cldn9 (NM_020293) Mouse Tagged ORF Clone

CAT#: MG202414

Cldn9 (GFP-tagged) - Mouse claudin 9 (Cldn9)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cldn9 (NM_020293) Mouse Tagged ORF Clone
Symbol Cldn9
Synonyms nmf329
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG202414 representing NM_020293
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCACTGGCCTTGAACTCCTCGGCATGACCCTGGCTGTGCTAGGCTGGCTAGGAACTTTGGTGT
CCTGTGCCCTGCCACTGTGGAAGGTGACCGCCTTCATCGGCAACAGCATCGTTGTGGCCCAAGTGGTATG
GGAGGGGCTGTGGATGTCCTGTGTGGTCCAGAGCACTGGCCAGATGCAGTGCAAAGTATACGACTCACTG
CTGGCGCTGCCCCAGGACCTGCAGGCAGCCAGAGCCCTCTGTGTCGTGGCCCTCCTGCTGGCTTTGCTGG
GCCTGCTGGTGGCTATCACGGGCGCCCAGTGCACCACGTGTGTGGAGGACGAAGGTGCCAAGGCCCGTAT
CGTACTCACCGCAGGGGTCCTCCTCCTCCTCTCGGGCATTTTGGTGCTCATCCCTGTCTGCTGGACAGCC
CATGCCATCATCCAGGATTTTTATAACCCACTGGTTGCGGAAGCCCTCAAGAGAGAACTGGGGGCTTCCC
TCTACCTGGGCTGGGCTGCCGCTGCCCTGCTCATGCTAGGGGGAGGGCTCCTCTGCTGTACGTGTCCCCC
GTCACACTTTGAGCGTCCCCGCGGCCCCAGGCTGGGCTACTCCATCCCTTCCCGTTCAGGTGCTTCGGGA
CTGGATAAGAGGGACTATGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202414 representing NM_020293
Red=Cloning site Green=Tags(s)

MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL
LALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTA
HAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASG
LDKRDYV

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_020293
ORF Size 651 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020293.3, NP_064689
RefSeq Size 1443
RefSeq ORF 654
Locus ID 56863
Cytogenetics 17|17 A3.3
Gene Summary This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is developmentally regulated; it is expressed in neonate kidney, but disappers by adulthood. It is required for the preservation of sensory cells in the hearing organ and the gene deficiency is associated with deafness. [provided by RefSeq, Aug 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)