Ralb (NM_022327) Mouse Tagged ORF Clone

CAT#: MG202182

  • TrueORF®

Ralb (tGFP-tagged) - Mouse v-ral simian leukemia viral oncogene homolog B (ras related) (Ralb)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_022327" in other vectors (4)

Reconstitution Protocol

USD 500.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Ralb Antibody - middle region
    • 100 ul

USD 539.00

Other products for "Ralb"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Ralb
Synonyms 5730472O18Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG202182 representing NM_022327
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCAACAAGGGCAAGAGCCAGGGCTCCCTGGTACTTCACAAGGTCATCATGGTTGGCAGTGGAG
GGGTCGGCAAATCAGCCCTGACGCTTCAGTTCATGTATGATGAGTTTGTAGAAGACTATGAGCCCACCAA
AGCTGACAGTTACAGAAAGAAGGTGGTTCTCGACGGAGAAGAGGTCCAGATAGACATCCTGGACACCGCT
GGCCAGGAGGACTATGCGGCCATCCGTGACAACTACTTCCGAAGCGGAGAAGGCTTTCTGCTGGTGTTCT
CCATCACAGAGCACGAGTCTTTCACAGCCACAGCCGAGTTCAGGGAACAGATTCTCCGAGTCAAGTCAGA
GGAGGACAAGATCCCACTGCTGGTCGTGGGCAACAAGTCCGACCTGGAGGAGCGGAGGCAGGTGCCTGTG
GACGAGGCCCGAGGCAAAGCGGAGGAGTGGGGTGTGCAGTACGTGGAGACATCTGCAAAGACCCGCGCCA
ATGTGGACAAGGTATTCTTTGATCTGATGAGAGAAATCCGGGCAAAAAAGATGTCAGAAAACAAGGACAA
GAACGGCAGGAAAAGCAGCAAGAGCAAGAAAAGTTTCAAAGAGCGATGCTGCTTGCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG202182 representing NM_022327
Red=Cloning site Green=Tags(s)

MAANKGKSQGSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
GQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPV
DEARGKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKKMSENKDKNGRKSSKSKKSFKERCCLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022327
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022327.5
RefSeq Size 2117 bp
RefSeq ORF 621 bp
Locus ID 64143
UniProt ID Q9JIW9
Cytogenetics 1 E2.3
Gene Summary Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis (By similarity). In late stages of cytokinesis, upon completion of the bridge formation between dividing cells, mediates exocyst recruitment to the midbody to drive abscission (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.