Golph3 (BC031445) Mouse Tagged ORF Clone

CAT#: MG201270

Golph3 (tGFP-tagged) - Mouse golgi phosphoprotein 3 (cDNA clone MGC:25472 IMAGE:4482612)

Product Images

Circular map for MG201270

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Golph3
• Synonyms: 4733401N08Rik; 5730410D03Rik; AW413496
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG201270 representing BC031445
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCTCGCTGACCCAGCGGAGCTCGGGCCTGGTGCAGCGGCGCACCGAGGCCTCCCGGAACGCTGCCG
  ACAAGGAGCGGGCGGCGGGAGGCGGCGGCGGCAGCGGCGAGGACGAGGCGCAGAGCCGCCGCGACGAGCA
  GGACGACGACGACAAGGGCGACTCCAAGGAAACGCGGCTGACCCTGATGGAGGAGGTGCTCCTGCTGGGC
  CTCAAGGACCGAGAGGGTTACACATCATTTTGGAATGACTGTATATCATCTGGATTACGTGGCTGTATGT
  TAATTGAATTAGCTTTGAGAGGAAGGTTACAGTTAGAGGCTTGTGGAATGAGAAGAAAAAGTCTTTTAAC
  CAGAAAGGTGATCTGTAAATCGGATGCTCCAACAGGGGATGTTCTTCTTGATGAAGCTCTAAAGCATGTT
  AAGGAGACTCAGCCTCCAGAGACAGTCCAGAACTGGATTGAGTTACTTAGTGGAGAGAACAGATAC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG201270 representing BC031445
  Red=Cloning site Green=Tags(s)
  
  MTSLTQRSSGLVQRRTEASRNAADKERAAGGGGGSGEDEAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG
  LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV
  KETQPPETVQNWIELLSGENRY
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC031445
• ORF Size: 486 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC031445.1
• RefSeq Size: 2861 bp
• RefSeq ORF: 488 bp
• Locus ID: 66629
• Cytogenetics: 15 A1
• Gene Summary: Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis (By similarity).[UniProtKB/Swiss-Prot Function]