Tmem107 (BC096686) Mouse Tagged ORF Clone

CAT#: MG200885

Tmem107 (GFP-tagged) - Mouse transmembrane protein 107 (cDNA clone MGC:106931 IMAGE:1446796)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 443.00


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Tmem107 (BC096686) Mouse Tagged ORF Clone
Symbol Tmem107
Synonyms RP23-19I2.5
Vector pCMV6-AC-GFP
Sequence Data
>MG200885 representing BC096686
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCGGATCTCCGGGCTCGTGCCCTCTCGGTTCCTGACGCTCTTGGCTCATCTGGTGGTTGTCATCA
CGTTGTTCTGGTCCCGGGAAAGCAACATCCAGGCTTGCCTGCCTCTCAAATTCACCCCGGAGGAATACGA
AAAGCAGGACAACCAGCTGGTAGCCGCGCTCTGTCTCACCCTGGGCCTCTTTGCAGTGGAGCTGGCTGGC
TTCCTCTCAGGAGTCTCCATGTTCAATAGCACCCAGAGCCTCCTCTCCATTGCAGCCCACTGTAGCGCGT
CTGTGGCCCTGTCTTTCTTCGTATTCGAGCGATGGGAATGTACCACGTACTGGTACATTTTTACCTTCTG
CAGCGCCTTCCCAGCTGTCACTGAAACTGCATTATTCATCGCTGTCTTTGGGCTGAAAAAGAAACCCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200885 representing BC096686
Red=Cloning site Green=Tags(s)

MGRISGLVPSRFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLTLGLFAVELAG
FLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAFPAVTETALFIAVFGLKKKPF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC096686
ORF Size 422 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC096686
RefSeq Size 768
RefSeq ORF 422
Locus ID 66910
Cytogenetics 11|11 B3
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.