Kcne1 (NM_008424) Mouse Tagged ORF Clone

CAT#: MG200709

Kcne1 (tGFP-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, member 1 (Kcne1)

Product Images

Circular map for MG200709

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Kcne1
• Synonyms: Isk; MinK; nmf190
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200709 representing NM_008424
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCCTGCCCAATTCCACGACTGTTCTGCCCTTTCTGGCCAGGCTGTGGCAGGAGACAGCTGAACAGG
  GCGGCAACGTGTCGGGCCTGGCTCGTAAGTCTCAGCTCCGAGATGACAGCAAGCTAGAGGCGCTCTACAT
  CCTCATGGTGCTGGGCTTCTTCGGCTTCTTCACCCTGGGCATCATGCTGAGTTACATCCGATCCAAGAAG
  CTGGAGCACTCCCACGACCCTTTCAACGTGTACATCGAGTCAGATGCCTGGCAGGAGAAAGGCAAGGCCG
  TCTTCCAGGCCCGTGTCCTGGAGAGCTTCAGAGCTTGCTATGTCATTGAAAACCAGGCGGCCGTAGAGCA
  GCCTGCCACACACCTTCCTGAACTGAAGCCATTGTCG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200709 representing NM_008424
  Red=Cloning site Green=Tags(s)
  
  MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKK
  LEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_008424
• ORF Size: 387 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_008424.1
• RefSeq Size: 3156 bp
• RefSeq ORF: 390 bp
• Locus ID: 16509
• UniProt ID: P23299
• Cytogenetics: 16 53.57 cM
• Gene Summary: Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr).[UniProtKB/Swiss-Prot Function]