H2al2a (NM_026627) Mouse Tagged ORF Clone

CAT#: MG200429

H2afb1 (tGFP-tagged) - Mouse RIKEN cDNA 1700113O17 gene (1700113O17Rik)

Product Images

Circular map for MG200429

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: H2al2a
• Synonyms: 1700113O17Rik; H2A; H2A.Bbd; H2A.L.2; H2ab1; H2afb; H2afb1; H2al2; Tseg; TSEG-1; Tseg1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200429 representing NM_026627
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCAGGAAAAGGCAAAGGCGAAGAAGACGGAAAGTGACCCGCTCCCAGAGAGCTGAGCTTCAATTTC
  CTGTTAGCCGTGTGGATCGTTTCCTACGAGAGGGAAACTATTCTAGACGCCTGAGCTCTTCTGCTCCTGT
  ATTCCTCGCGGGTGTGCTCGAGTACTTAACATCTAACATCCTTGAACTGGCTGGTGAGGTGGCCCACACC
  ACTGGCAGGAAGCGCATAGCTCCAGAGCATGTGTGCCGTGTGGTACAGAACAACGAACAGCTCCACCAAC
  TCTTCAAACAAGGTGGCACATCAGTGTTTGAGCCACCAGAACCTGATGACAAC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200429 representing NM_026627
  Red=Cloning site Green=Tags(s)
  
  MARKRQRRRRRKVTRSQRAELQFPVSRVDRFLREGNYSRRLSSSAPVFLAGVLEYLTSNILELAGEVAHT
  TGRKRIAPEHVCRVVQNNEQLHQLFKQGGTSVFEPPEPDDN
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_026627
• ORF Size: 333 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_026627.2, NP_080903.1
• RefSeq Size: 525 bp
• RefSeq ORF: 336 bp
• Locus ID: 68231
• UniProt ID: Q9CQ70
• Cytogenetics: 2 A3
• Gene Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. [provided by RefSeq, Nov 2015]