Cd24a (NM_009846) Mouse Tagged ORF Clone

CAT#: MG200107

Cd24a (tGFP-tagged) - Mouse CD24a antigen (Cd24a)

Product Images

Circular map for MG200107

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Cd24a
• Synonyms: Cd24; HSA; Ly-52; nectadrin
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200107 representing NM_009846
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCAGAGCGATGGTGGCCAGGCTAGGGCTGGGGTTGCTGCTTCTGGCACTGCTCCTACCCACGCAGA
  TTTACTGCAACCAAACATCTGTTGCACCGTTTCCCGGTAACCAGAATATTTCTGCTTCCCCAAATCCAAG
  TAACGCTACCACCAGAGGGGGTGGCAGCTCCCTGCAGTCCACAGCTGGTCTCCTGGCTCTCTCTCTCTCT
  CTTCTACATCTCTACTGT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200107 representing NM_009846
  Red=Cloning site Green=Tags(s)
  
  MGRAMVARLGLGLLLLALLLPTQIYCNQTSVAPFPGNQNISASPNPSNATTRGGGSSLQSTAGLLALSLS
  LLHLYC
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_009846
• ORF Size: 228 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_009846.2, NP_033976.1
• RefSeq Size: 1825 bp
• RefSeq ORF: 231 bp
• Locus ID: 12484
• UniProt ID: P24807
• Cytogenetics: 10 23.01 cM
• Gene Summary: May have a pivotal role in cell differentiation of different cell types. May have a specific role in early thymocyte development. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses (By similarity). In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90 (PubMed:19264983). Plays a role in the control of autoimmunity (PubMed:20200274).[UniProtKB/Swiss-Prot Function]