BPNT1 Rabbit Polyclonal Antibody

CAT#: TA344274

Rabbit Polyclonal Anti-BPNT1 Antibody - N-terminal region

Product Images

WB Suggested Anti-BPNT1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BPNT1 antibody: synthetic peptide directed towards the N terminal of human BPNT1. Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: 3'(2'), 5'-bisphosphate nucleotidase 1
• Database Link:
  NP_006076
  Entrez Gene 10380 Human
  UniProt ID O95861
• Background: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
• Synonyms: HEL20; PIP
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 91%; Horse: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Sulfur metabolism