BPNT1 (NM_006085) Human Recombinant Protein

CAT#: TP316622

Recombinant protein of human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 20 µg

Product Images

Coomassie blue staining of purified BPNT1 protein (Cat# TP316622). The protein was produced from HEK293T cells transfected with BPNT1 cDNA clone (Cat# RC216622) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216622 representing NM_006085
  Red=Cloning site Green=Tags(s)
  
  MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT
  IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA
  YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM
  NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN
  SAGVLATLRNYDYYASRVPESIKNALVP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006076
• Locus ID: 10380
• UniProt ID: O95861, V9HWF9
• Cytogenetics: 1q41
• Refseq Size: 2461
• Refseq ORF: 924
• Synonyms: HEL20; PIP
• Summary: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]
• Protein Pathways: Sulfur metabolism