BPNT1 (NM_006085) Human Recombinant Protein
CAT#: TP316622
Recombinant protein of human 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216622 representing NM_006085
Red=Cloning site Green=Tags(s) MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLT IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIA YEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAM NPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMN SAGVLATLRNYDYYASRVPESIKNALVP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006076 |
Locus ID | 10380 |
UniProt ID | O95861, V9HWF9 |
Cytogenetics | 1q41 |
Refseq Size | 2461 |
Refseq ORF | 924 |
Synonyms | HEL20; PIP |
Summary | BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008] |
Protein Pathways | Sulfur metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416871 | BPNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416871 | Transient overexpression lysate of 3'(2'), 5'-bisphosphate nucleotidase 1 (BPNT1) |
USD 436.00 |
|
PH316622 | BPNT1 MS Standard C13 and N15-labeled recombinant protein (NP_006076) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review