FBXL12 Rabbit Polyclonal Antibody

CAT#: TA342606

Rabbit Polyclonal Anti-FBXL12 Antibody

Product Images

WB Suggested Anti-FBXL12 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FBXL12 antibody: synthetic peptide directed towards the C terminal of human FBXL12. Synthetic peptide located within the following region: PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: F-box and leucine-rich repeat protein 12
• Database Link:
  NP_060173
  Entrez Gene 54850 Human
  UniProt ID Q9NXK8
• Background: Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).
• Synonyms: Fbl12
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome