FBXL12 (NM_017703) Human Recombinant Protein
CAT#: TP300178
Recombinant protein of human F-box and leucine-rich repeat protein 12 (FBXL12), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200178 protein sequence
Red=Cloning site Green=Tags(s) MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASR LHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAW LHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVL GCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLT MPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060173 |
Locus ID | 54850 |
UniProt ID | Q9NXK8 |
Cytogenetics | 19p13.2 |
Refseq Size | 1876 |
Refseq ORF | 978 |
Synonyms | Fbl12 |
Summary | Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413611 | FBXL12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413611 | Transient overexpression lysate of F-box and leucine-rich repeat protein 12 (FBXL12) |
USD 436.00 |
|
PH300178 | FBXL12 MS Standard C13 and N15-labeled recombinant protein (NP_060173) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review