FBXL12 (NM_017703) Human Recombinant Protein

CAT#: TP300178

Recombinant protein of human F-box and leucine-rich repeat protein 12 (FBXL12), 20 µg

Product Images

Coomassie blue staining of purified FBXL12 protein (Cat# TP300178). The protein was produced from HEK293T cells transfected with FBXL12 cDNA clone (Cat# RC200178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASR
  LHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAW
  LHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVL
  GCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLT
  MPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060173
• Locus ID: 54850
• UniProt ID: Q9NXK8
• Cytogenetics: 19p13.2
• Refseq Size: 1876
• Refseq ORF: 978
• Synonyms: Fbl12
• Summary: Members of the F-box protein family, such as FBXL12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome