Achaete scute homolog 3 (ASCL3) Rabbit Polyclonal Antibody

CAT#: TA342342

Rabbit Polyclonal Anti-Ascl3 Antibody

Product Images

WB Suggested Anti-Ascl3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Mouse Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ascl3 antibody: synthetic peptide directed towards the middle region of mouse Ascl3. Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: achaete-scute family bHLH transcription factor 3
• Database Link:
  NP_065697
  Entrez Gene 56787 Mouse
  UniProt ID Q9NQ33
• Background: Transcriptional repressor. Inhibits myogenesis.
• Synonyms: bHLHa42; HASH3; SGN1
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Bovine: 92%; Dog: 85%; Pig: 85%; Human: 85%; Guinea pig: 85%; Horse: 77%