Achaete scute homolog 3 (ASCL3) (NM_020646) Human Recombinant Protein

CAT#: TP320042

Recombinant protein of human achaete-scute complex homolog 3 (Drosophila) (ASCL3), 20 µg

Product Images

Coomassie blue staining of purified ASCL3 protein (Cat# TP320042). The protein was produced from HEK293T cells transfected with ASCL3 cDNA clone (Cat# RC220042) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220042 representing NM_020646
  Red=Cloning site Green=Tags(s)
  
  MMDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSE
  PCPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIK
  YINYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065697
• Locus ID: 56676
• UniProt ID: Q9NQ33
• Cytogenetics: 11p15.4
• Refseq Size: 650
• Refseq ORF: 543
• Synonyms: bHLHa42; HASH3; SGN1
• Summary: Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIM, Mar 2008]