Annexin A3 (ANXA3) Rabbit Polyclonal Antibody

CAT#: TA341650

Rabbit Polyclonal Anti-ANXA3 Antibody

Product Images

WB Suggested Anti-ANXA3 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: annexin A3
• Database Link:
  NP_005130
  Entrez Gene 306 Human
  UniProt ID P12429
• Background: This gene encodes a member ofThe annexin family. Members ofThis calcium-dependent phospholipid-binding protein family play a role inThe regulation of cellular growth and in signal transduction pathways.This protein functions inThe inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008]
• Synonyms: ANX3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%; Bovine: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency