NIT2 Rabbit Polyclonal Antibody

CAT#: TA339349

Rabbit Polyclonal Anti-NIT2 Antibody

Product Images

WB Suggested Anti-NIT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NIT2 antibody: synthetic peptide directed towards the middle region of human NIT2. Synthetic peptide located within the following region: VAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: nitrilase family member 2
• Database Link:
  NP_064587
  Entrez Gene 56954 Human
  UniProt ID Q9NQR4
• Background: NIT2 belongs to the UPF0012 family and contains 1 CN hydrolase domain. Overexpression of NIT2 decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.
• Synonyms: HEL-S-8a
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%; Yeast: 79%