Cyclophilin A (PPIA) Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PPIA antibody: synthetic peptide directed towards the middle region of human PPIA. Synthetic peptide located within the following region: TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 18 kDa |
Gene Name | peptidylprolyl isomerase A |
Database Link | |
Background | PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a cyclosporin binding-protein. It may play a role in cyclosporin A-mediated immunosuppression. This protein can interact with several HIV proteins including p55 gag, Vpr, and capsid protein. It has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. Three alternatively spliced transcript variants encoding two distinct isoforms have been observed. |
Synonyms | CYPA; CYPH; HEL-S-69p |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review