MVB12B Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MVB12B Antibody is: synthetic peptide directed towards the C-terminal region of Human MVB12B. Synthetic peptide located within the following region: HISLTLPATFRGRNSTRTDYEYQHSNLYAISAMDGVPFMISEKFSCVPES |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | multivesicular body subunit 12B |
Database Link | |
Background | The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | C9orf28; FAM125B |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 85% |
Reference Data | |
Protein Pathways | Endocytosis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review