FAM50B Rabbit Polyclonal Antibody

CAT#: TA334436

Rabbit Polyclonal Anti-FAM50B Antibody

Product Images

WB Suggested Anti-FAM50B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM50B antibody: synthetic peptide directed towards the N terminal of human FAM50B. Synthetic peptide located within the following region: IAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: family with sequence similarity 50 member B
• Database Link:
  NP_036267
  Entrez Gene 26240 Human
  UniProt ID Q9Y247
• Background: The exact function of FAM50B remains unknown.
• Synonyms: D6S2654E; X5L
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish: 79%