FAM50B (NM_012135) Human Recombinant Protein

CAT#: TP301531

Recombinant protein of human family with sequence similarity 50, member B (FAM50B), 20 µg

Product Images

Coomassie blue staining of purified FAM50B protein (Cat# TP301531). The protein was produced from HEK293T cells transfected with FAM50B cDNA clone (Cat# RC201531) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201531 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTL
  NDMKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAG
  NLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAQREKVKDEEMEVTFSYWDGSGHRRTVRVRKGNTVQ
  QFLKKALQGLRKDFLELRSAGVEQLMFIKEDLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDA
  TMEKDESHAGKVVLRSWYEKNKHIFPASRWEAYDPEKKWDKYTIR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036267
• Locus ID: 26240
• UniProt ID: Q9Y247, A0A024QZY3
• Cytogenetics: 6p25.2
• Refseq Size: 1618
• Refseq ORF: 975
• Synonyms: D6S2654E; X5L
• Summary: This gene contains an intronless ORF that arose from ancestral retroposition. The encoded protein is related to a plant protein that plays a role in the circadian clock. This gene is adjacent to a differentially methylated region (DMR) and is imprinted and paternally expressed in many tissues. [provided by RefSeq, Nov 2015]