TFIIF (GTF2F2) Rabbit Polyclonal Antibody

CAT#: TA329284

Rabbit Polyclonal anti-GTF2F2 antibody

Product Images

WB Suggested Anti-GTF2F2 Antibody Titration: 1.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-GTF2F2 Antibody; Paraffin Embedded Tissue: Human Brain; Cellular Data: Neural Cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-GTF2F2 Antibody; Paraffin Embedded Tissue: Human Spermatophore; Cellular Data: Epithelial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2. Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: general transcription factor IIF subunit 2
• Database Link:
  NP_004119
  Entrez Gene 68705 MouseEntrez Gene 2963 Human
  UniProt ID P13984
• Background: GTF2F2 synergizes with HIV-1 Tat and the cellular coactivator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter.
• Synonyms: BTF4; RAP30; TF2F2; TFIIF
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors