Products

cDNA Clones (19)
Antibodies (11)
Proteins (7)
Jump to Filters
View as table Download
GALNT10 (NM_017540) Human Tagged ORF Clone
RG214895

USD 500.00

3 Weeks

GALNT10 (tGFP-tagged) - Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GALNT10 (NM_198321) Human Tagged ORF Clone
RG223834

USD 761.00

3 Weeks

GALNT10 (tGFP-tagged) - Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
TA809431S

USD 200.00

In Stock

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA809396S

USD 200.00

2 Days

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GALNT10 (NM_198321) Human Tagged Lenti ORF Clone
RC223834L1

USD 861.00

In Stock

Lenti ORF clone of Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GALNT10 (NM_198321) Human Over-expression Lysate
LC405019

USD 206.00

In Stock

GALNT10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
GALNT10 (NM_017540) Human Tagged Lenti ORF Clone
RC214895L4

USD 600.00

3 Weeks

Lenti ORF clone of Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALNT10 (NM_198321) Human Tagged Lenti ORF Clone
RC223834L2

USD 861.00

3 Weeks

Lenti ORF clone of Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GALNT10 (NM_198321) Human Tagged Lenti ORF Clone
RC223834L3

USD 861.00

3 Weeks

Lenti ORF clone of Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GALNT10 (NM_198321) Human Tagged Lenti ORF Clone
RC223834L4

USD 861.00

3 Weeks

Lenti ORF clone of Human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GALNT10 (NM_017540) Human Over-expression Lysate
LC413728

USD 134.00

In Stock

GALNT10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
GALNT10 (NM_198321) Human Over-expression Lysate
LY405019

USD 665.00

5 Days

Transient overexpression lysate of UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
GALNT10 Rabbit Polyclonal Antibody
TA346785

USD 539.00

5 Days

Rabbit Polyclonal Anti-GALNT10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALNT10 antibody: synthetic peptide directed towards the N terminal of human GALNT10. Synthetic peptide located within the following region: VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS
GALNT10 (NM_017540) Human Over-expression Lysate
LC429543

USD 134.00

In Stock

GALNT10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T