Products

View as table Download

Rabbit Polyclonal Anti-CHST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST1 antibody: synthetic peptide directed towards the middle region of human CHST1. Synthetic peptide located within the following region: YRLWRLWYGTGRKPYNLDVTQLTTVCEDFSNSVSTGLMRPPWLKGKYMLV

Rabbit Polyclonal Anti-CHST1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST1 antibody: synthetic peptide directed towards the N terminal of human CHST1. Synthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL