Products

Proteins (14)
cDNA Clones (14)
Antibodies (7)
Jump to Filters
View as table Download
BUB3 Rabbit Polyclonal Antibody
AP20475PU-N

USD 465.00

3 Weeks

BUB3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 251-300 of Human BUB3.
BUB3 Rabbit Polyclonal Antibody
TA344273

USD 539.00

5 Days

Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
BUB3 Rabbit Polyclonal Antibody
TA306431

USD 570.00

5 Days

Rabbit Polyclonal Bub3 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bub3 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human bub3.
BUB3 Rabbit Polyclonal Antibody
TA350151

USD 380.00

In Stock

Rabbit Polyclonal Anti-BUB3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BUB3
BUB3 Mouse Monoclonal Antibody [Clone ID: AT2H6]
AM50343PU-N

USD 430.00

3 Weeks

BUB3 mouse monoclonal antibody, clone AT2H6, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
BUB3 Mouse Monoclonal Antibody [Clone ID: AT2H6]
AM50343PU-S

USD 315.00

3 Weeks

BUB3 mouse monoclonal antibody, clone AT2H6, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
BUB3 Rabbit Polyclonal Antibody
TA311823

USD 380.00

4 Weeks

Rabbit polyclonal anti-BUB3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human BUB3.
Modifications Phospho-specific