BUB3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 251-300 of Human BUB3. |
BUB3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 251-300 of Human BUB3. |
Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR |
Rabbit Polyclonal Bub3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bub3 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human bub3. |
Rabbit Polyclonal Anti-BUB3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BUB3 |
BUB3 mouse monoclonal antibody, clone AT2H6, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BUB3 mouse monoclonal antibody, clone AT2H6, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-BUB3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human BUB3. |
Modifications | Phospho-specific |