Products

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 8 of 8 results

(reset)

MSH2 Mouse Monoclonal Antibody [Clone ID: UMAB259]

UM800149

USD 564.00

In Stock

MSH2 mouse monoclonal antibody,clone UMAB259

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: UMAB259]

UM800149CF

USD 657.00

3 Days

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody,clone UMAB259

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: OTI10F7]

TA814210

USD 447.00

In Stock

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: OTI10F7]

CF814210

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody, clone OTI10F7

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MSH2 Mouse Monoclonal Antibody [Clone ID: UMAB259]

UM870149

USD 224.00

In Stock

MSH2 mouse monoclonal antibody,clone UMAB259

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MSH2 Mouse Monoclonal Antibody [Clone ID: OTI10F7]

TA814210S

USD 200.00

2 Days

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MSH2 Rabbit Polyclonal Antibody

TA313355

USD 380.00

4 Weeks

Rabbit polyclonal anti-MSH2 antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human MSH2.

1 / 2

2 / 2

Previous Next

MSH2 Rabbit Polyclonal Antibody

TA346018

USD 539.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG

1 / 2

2 / 2

Previous Next

1 - 8 of 8 results