MSH2 Rabbit Polyclonal Antibody

CAT#: TA346018

Reviews ()
Write a review

Rabbit Polyclonal Anti-MSH2 Antibody



USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 105 kDa
Gene Name mutS homolog 2
Background MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms COCA1; FCC1; HNPCC; HNPCC1; LCFS2
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Colorectal cancer, Mismatch repair, Pathways in cancer
Other products for "MSH2"
Frequently bought together (3)
Recombinant protein of human mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) (MSH2)
    • 20 ug

USD 748.00


Transient overexpression lysate of mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) (MSH2)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies