Research Areas

cDNA Clones (24)
Antibodies (3)
Proteins (2)
Jump to Filters
View as table Download
PPP2R3A (NM_181897) Human Over-expression Lysate
LY405582

USD 665.00

In Stock

Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha (PPP2R3A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R3A (NM_002718) Human Over-expression Lysate
LY419144

USD 436.00

In Stock

Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha (PPP2R3A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PPP2R3A (NM_002718) Human Tagged ORF Clone Lentiviral Particle
RC209027L3V

USD 2,051.00

7 Weeks

Lenti ORF particles, PPP2R3A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PPP2R3A (NM_002718) Human Tagged ORF Clone Lentiviral Particle
RC209027L4V

USD 2,051.00

7 Weeks

Lenti ORF particles, PPP2R3A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PPP2R3A (NM_001190447) Human Tagged ORF Clone Lentiviral Particle
RC230827L3V

USD 1,282.00

7 Weeks

Lenti ORF particles, PPP2R3A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PPP2R3A (NM_001190447) Human Tagged ORF Clone Lentiviral Particle
RC230827L4V

USD 1,282.00

7 Weeks

Lenti ORF particles, PPP2R3A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

PPP2R3A Rabbit Polyclonal Antibody
TA337691

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP2R3A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R3A antibody: synthetic peptide directed towards the N terminal of human PPP2R3A. Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
PPP2R3A (NM_002718) Human Tagged Lenti ORF Clone
RC209027L3

USD 1,801.00

3 Weeks

Lenti-ORF clone of PPP2R3A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R3A (NM_002718) Human Tagged Lenti ORF Clone
RC209027L4

USD 1,801.00

3 Weeks

Lenti-ORF clone of PPP2R3A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R3A (NM_181897) Human Tagged Lenti ORF Clone
RC215798L3

USD 792.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R3A (NM_001190447) Human Tagged Lenti ORF Clone
RC230827L3

USD 1,032.00

3 Weeks

Lenti-ORF clone of PPP2R3A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R3A (NM_001190447) Human Tagged Lenti ORF Clone
RC230827L4

USD 1,032.00

3 Weeks

Lenti-ORF clone of PPP2R3A (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PPP2R3A (NM_181897) Human Untagged Clone
SC107434

USD 493.00

In Stock

PPP2R3A (untagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PPP2R3A (NM_002718) Human Untagged Clone
SC125495

USD 1,002.00

In Stock

PPP2R3A (untagged)-Human protein phosphatase 2, regulatory subunit B'', alpha (PPP2R3A), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None