Research Areas

View as table Download

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit Polyclonal anti-GNAS antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Rabbit polyclonal MITF (Ab-180/73) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M).

Anti-MC1R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 301-315 amino acids of human melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor)

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

Anti-POMC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of Human proopiomelanocortin

Anti-TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase

Anti-MITF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 173 amino acids of human matrix metallopeptidase 28

Rabbit Polyclonal Anti-CREB3L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF

Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M).
Modifications Phospho-specific

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha