Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-GGT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GGT1 |
TA350015 is a possible alternative to TA323391.
Liver Diseases
View as table Download
Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954) |
Rabbit Polyclonal Anti-GPT Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
Rabbit polyclonal Cytochrome P450 4F2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2. |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon (Predicted: Bovine, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
Active filters
Applications
- IHC
Pathways
- Metabolic pathways
Availabilities
- In Stock