Germany
Japan
United Kingdom
China
Immunology
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit Polyclonal antibody to Pyruvate Dehydrogenase E1 alpha (pyruvate dehydrogenase (lipoamide) alpha 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chimpanzee, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 325 of (Uniprot ID#P08559) |
PDHA1 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PDHA1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PDHA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP |
PDHA1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 233~263 amino acids from the Central region of Human PDHA1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PDHA1
Pathways
- Pyruvate metabolism