Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Mouse Monoclonal Caspase-3 Antibody (31A893)
Applications | ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACTB |
Rabbit Polyclonal Anti-ICAM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ICAM1 |
Rabbit Polyclonal Anti-ICAM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ICAM1 |
Anti-CASP3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
Anti-ITGAL Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1158-1170 amino acids of Human integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) |
Rabbit polyclonal CASP3(Asp175) Antibody
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP3(Asp175) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-179 amino acids from human CASP3(Asp175). |
Rabbit Polyclonal Anti-SMURF2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMURF2 |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP3 |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Anti-CASP3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |